Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WIM1

Protein Details
Accession B2WIM1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-79TPSPYRPTAPQPTKNKKKKNGPPLSMHydrophilic
NLS Segment(s)
PositionSequence
68-72NKKKK
Subcellular Location(s) mito 16, cyto 7, cyto_nucl 6, nucl 3
Family & Domain DBs
Amino Acid Sequences MGMLTLEEVGEERMWGYTYMLQKEDTYNQKQNPLHLQATTTNAGGDKSGWTLFTPSPYRPTAPQPTKNKKKKNGPPLSMIPPNGSSPVLTPTKTPPLHFASLRLPVNLCTGPSSGHLLRLATCCSSPRLGEIKWKGGVKFLGFVVEFYCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.14
5 0.19
6 0.22
7 0.23
8 0.23
9 0.23
10 0.26
11 0.32
12 0.35
13 0.37
14 0.42
15 0.43
16 0.51
17 0.51
18 0.52
19 0.53
20 0.51
21 0.45
22 0.38
23 0.37
24 0.31
25 0.34
26 0.31
27 0.23
28 0.17
29 0.16
30 0.15
31 0.13
32 0.11
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.11
39 0.11
40 0.16
41 0.18
42 0.18
43 0.22
44 0.23
45 0.24
46 0.24
47 0.3
48 0.35
49 0.4
50 0.48
51 0.54
52 0.64
53 0.73
54 0.81
55 0.83
56 0.82
57 0.85
58 0.85
59 0.86
60 0.85
61 0.77
62 0.73
63 0.69
64 0.66
65 0.58
66 0.49
67 0.39
68 0.31
69 0.28
70 0.23
71 0.18
72 0.12
73 0.1
74 0.14
75 0.14
76 0.13
77 0.14
78 0.16
79 0.25
80 0.26
81 0.26
82 0.27
83 0.3
84 0.34
85 0.33
86 0.32
87 0.28
88 0.34
89 0.34
90 0.29
91 0.25
92 0.22
93 0.25
94 0.23
95 0.19
96 0.14
97 0.14
98 0.14
99 0.15
100 0.2
101 0.16
102 0.19
103 0.19
104 0.18
105 0.2
106 0.21
107 0.22
108 0.17
109 0.18
110 0.17
111 0.19
112 0.2
113 0.18
114 0.21
115 0.25
116 0.25
117 0.34
118 0.38
119 0.41
120 0.45
121 0.48
122 0.42
123 0.42
124 0.45
125 0.37
126 0.34
127 0.28
128 0.27
129 0.24
130 0.24