Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0RY08

Protein Details
Accession A0A0L0RY08    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-41RPRLQATCPPQRPRPSTPRCRVRLASHydrophilic
NLS Segment(s)
PositionSequence
45-59AGSRRRAARRRGLAR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MSWLPLPRTHLLLLPRPRLQATCPPQRPRPSTPRCRVRLASGGLAGSRRRAARRRGLARAWGPCRRCTQMRRRSQAAANRSAWDRRRLSVEVDPTLAQHETIRRHAQKLTAMRTTISRHKSLAAKMGHAALAATPPTILHRPDPLLASATDDAGASMTASMSSATQAAMALLARNPDDAETDDWAAALQAVGRRKSVAGPMGADRQSDTLTRSSSRSAPPTSGKLRRSGSTATAAHAPSRSRCSSTLYAEIAGPRDLPLGAADLMPRHNRLSAASTSGSDTVPYFVVPSRLLDPLHEAVDLALDDPQPLLPPPQPDPPAASGTEEPAVSLPPAVLVPSGLEGVPGVRARHASSHALGVRYWRPASLMGATATALMPPPTTTGGGQLTGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.5
4 0.51
5 0.49
6 0.48
7 0.49
8 0.49
9 0.53
10 0.58
11 0.63
12 0.69
13 0.78
14 0.8
15 0.79
16 0.81
17 0.81
18 0.83
19 0.86
20 0.87
21 0.82
22 0.83
23 0.77
24 0.72
25 0.7
26 0.64
27 0.57
28 0.49
29 0.44
30 0.37
31 0.37
32 0.31
33 0.26
34 0.26
35 0.26
36 0.32
37 0.39
38 0.47
39 0.54
40 0.64
41 0.69
42 0.72
43 0.73
44 0.74
45 0.73
46 0.74
47 0.71
48 0.68
49 0.63
50 0.6
51 0.61
52 0.58
53 0.6
54 0.6
55 0.63
56 0.66
57 0.73
58 0.76
59 0.76
60 0.75
61 0.74
62 0.73
63 0.69
64 0.67
65 0.59
66 0.55
67 0.53
68 0.54
69 0.51
70 0.51
71 0.46
72 0.4
73 0.44
74 0.42
75 0.43
76 0.42
77 0.44
78 0.37
79 0.36
80 0.34
81 0.28
82 0.28
83 0.23
84 0.17
85 0.14
86 0.17
87 0.19
88 0.25
89 0.34
90 0.34
91 0.37
92 0.39
93 0.4
94 0.42
95 0.46
96 0.47
97 0.41
98 0.39
99 0.37
100 0.38
101 0.39
102 0.4
103 0.37
104 0.33
105 0.3
106 0.34
107 0.38
108 0.37
109 0.4
110 0.33
111 0.3
112 0.29
113 0.29
114 0.24
115 0.19
116 0.17
117 0.09
118 0.09
119 0.08
120 0.07
121 0.05
122 0.05
123 0.08
124 0.1
125 0.11
126 0.12
127 0.15
128 0.16
129 0.18
130 0.19
131 0.17
132 0.16
133 0.15
134 0.17
135 0.14
136 0.12
137 0.11
138 0.1
139 0.09
140 0.07
141 0.07
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.06
164 0.07
165 0.08
166 0.09
167 0.09
168 0.1
169 0.1
170 0.09
171 0.09
172 0.08
173 0.06
174 0.05
175 0.04
176 0.06
177 0.09
178 0.1
179 0.1
180 0.11
181 0.11
182 0.13
183 0.14
184 0.14
185 0.12
186 0.13
187 0.15
188 0.19
189 0.19
190 0.18
191 0.16
192 0.14
193 0.14
194 0.13
195 0.13
196 0.11
197 0.12
198 0.13
199 0.14
200 0.15
201 0.18
202 0.21
203 0.23
204 0.23
205 0.25
206 0.26
207 0.31
208 0.37
209 0.4
210 0.39
211 0.41
212 0.42
213 0.39
214 0.4
215 0.36
216 0.31
217 0.3
218 0.29
219 0.24
220 0.26
221 0.25
222 0.23
223 0.23
224 0.22
225 0.17
226 0.23
227 0.23
228 0.22
229 0.23
230 0.28
231 0.3
232 0.32
233 0.34
234 0.29
235 0.28
236 0.26
237 0.26
238 0.21
239 0.17
240 0.14
241 0.1
242 0.09
243 0.08
244 0.08
245 0.07
246 0.07
247 0.07
248 0.08
249 0.08
250 0.08
251 0.12
252 0.13
253 0.15
254 0.14
255 0.14
256 0.15
257 0.16
258 0.2
259 0.18
260 0.2
261 0.19
262 0.19
263 0.19
264 0.2
265 0.18
266 0.14
267 0.13
268 0.1
269 0.1
270 0.09
271 0.09
272 0.08
273 0.11
274 0.11
275 0.13
276 0.14
277 0.16
278 0.16
279 0.15
280 0.2
281 0.19
282 0.2
283 0.17
284 0.15
285 0.12
286 0.13
287 0.13
288 0.08
289 0.07
290 0.07
291 0.07
292 0.07
293 0.07
294 0.07
295 0.08
296 0.11
297 0.12
298 0.16
299 0.2
300 0.28
301 0.3
302 0.3
303 0.34
304 0.34
305 0.34
306 0.31
307 0.3
308 0.23
309 0.24
310 0.24
311 0.19
312 0.16
313 0.14
314 0.14
315 0.11
316 0.1
317 0.07
318 0.06
319 0.07
320 0.07
321 0.06
322 0.06
323 0.06
324 0.07
325 0.08
326 0.07
327 0.07
328 0.07
329 0.07
330 0.11
331 0.13
332 0.13
333 0.14
334 0.16
335 0.18
336 0.22
337 0.26
338 0.27
339 0.26
340 0.33
341 0.34
342 0.34
343 0.32
344 0.34
345 0.34
346 0.36
347 0.35
348 0.27
349 0.26
350 0.26
351 0.29
352 0.26
353 0.24
354 0.19
355 0.19
356 0.19
357 0.18
358 0.16
359 0.13
360 0.11
361 0.09
362 0.09
363 0.09
364 0.11
365 0.13
366 0.14
367 0.14
368 0.18
369 0.2