Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SLB4

Protein Details
Accession A0A0L0SLB4   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-49DDETCGRPAKRRAIRKRGQGVPDBasic
97-133DEEVVEKKPRKRKRGKEAKRSKKEGKRERRRRTATGABasic
NLS Segment(s)
PositionSequence
34-43PAKRRAIRKR
103-128KKPRKRKRGKEAKRSKKEGKRERRRR
Subcellular Location(s) cyto 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MTTSNSTLQLLFSSAVGDDPGAASSSDDETCGRPAKRRAIRKRGQGVPDIDPLDLPMPSAPVDRAWVEDDEHLAFLAQVEDVQRILAADEQGASDEDEEVVEKKPRKRKRGKEAKRSKKEGKRERRRRTATGAEEGAEPVAALDDPSLMSLMFATGLVSAFDSAPTATAPRGAPAYVIAALPRVAHVLSGADDRDDQCVVCLHALSRPPSDGAAVDGDSLVPLLIPLPCLHTFHEECAVKCLEARPTCPVCRFDVVAAYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.06
6 0.06
7 0.07
8 0.07
9 0.07
10 0.07
11 0.08
12 0.11
13 0.11
14 0.11
15 0.12
16 0.13
17 0.17
18 0.23
19 0.24
20 0.29
21 0.36
22 0.46
23 0.54
24 0.63
25 0.7
26 0.75
27 0.81
28 0.84
29 0.87
30 0.84
31 0.79
32 0.76
33 0.69
34 0.63
35 0.6
36 0.5
37 0.41
38 0.32
39 0.29
40 0.23
41 0.18
42 0.14
43 0.08
44 0.08
45 0.09
46 0.1
47 0.09
48 0.09
49 0.11
50 0.11
51 0.13
52 0.14
53 0.14
54 0.15
55 0.15
56 0.16
57 0.14
58 0.14
59 0.12
60 0.09
61 0.08
62 0.07
63 0.07
64 0.05
65 0.04
66 0.05
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.12
89 0.17
90 0.24
91 0.33
92 0.42
93 0.52
94 0.62
95 0.71
96 0.77
97 0.84
98 0.88
99 0.9
100 0.93
101 0.93
102 0.92
103 0.9
104 0.89
105 0.86
106 0.86
107 0.85
108 0.85
109 0.86
110 0.87
111 0.89
112 0.9
113 0.87
114 0.81
115 0.78
116 0.75
117 0.67
118 0.6
119 0.5
120 0.4
121 0.34
122 0.3
123 0.22
124 0.13
125 0.09
126 0.04
127 0.04
128 0.03
129 0.03
130 0.02
131 0.03
132 0.03
133 0.03
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.08
156 0.08
157 0.09
158 0.1
159 0.09
160 0.09
161 0.09
162 0.11
163 0.09
164 0.09
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.09
177 0.08
178 0.08
179 0.1
180 0.1
181 0.12
182 0.12
183 0.1
184 0.1
185 0.11
186 0.11
187 0.1
188 0.1
189 0.09
190 0.12
191 0.16
192 0.19
193 0.19
194 0.19
195 0.2
196 0.2
197 0.2
198 0.17
199 0.14
200 0.13
201 0.12
202 0.11
203 0.1
204 0.09
205 0.08
206 0.08
207 0.06
208 0.04
209 0.03
210 0.04
211 0.04
212 0.06
213 0.06
214 0.12
215 0.13
216 0.15
217 0.18
218 0.24
219 0.26
220 0.27
221 0.36
222 0.34
223 0.33
224 0.36
225 0.36
226 0.28
227 0.29
228 0.3
229 0.3
230 0.3
231 0.33
232 0.37
233 0.42
234 0.47
235 0.51
236 0.5
237 0.46
238 0.47
239 0.46
240 0.39