Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T9M4

Protein Details
Accession A0A0L0T9M4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
123-152ALPRQGRRLQLPRKTKRKGINRPQWSCRYLHydrophilic
NLS Segment(s)
PositionSequence
117-142GGRRAAALPRQGRRLQLPRKTKRKGI
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MHVAGTAKRDRIVKEARVARLPPTVAPTAILLHPTVLAKLVEVTDKSLPQLGVGVMPSHPLEPTVTFTEPTVTFTEPTVTFTELAPTSATTTSPTPLPATRSPLSRHDGLPASRSLGGRRAAALPRQGRRLQLPRKTKRKGINRPQWSCRYLSRPPRIWNIPQSQSSRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.55
4 0.57
5 0.56
6 0.51
7 0.48
8 0.44
9 0.36
10 0.33
11 0.3
12 0.24
13 0.24
14 0.21
15 0.18
16 0.18
17 0.17
18 0.12
19 0.11
20 0.12
21 0.11
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.13
31 0.13
32 0.14
33 0.14
34 0.16
35 0.15
36 0.13
37 0.13
38 0.1
39 0.09
40 0.09
41 0.09
42 0.07
43 0.08
44 0.09
45 0.08
46 0.08
47 0.07
48 0.08
49 0.08
50 0.12
51 0.14
52 0.14
53 0.14
54 0.14
55 0.17
56 0.16
57 0.17
58 0.16
59 0.13
60 0.13
61 0.13
62 0.16
63 0.13
64 0.15
65 0.14
66 0.13
67 0.13
68 0.12
69 0.14
70 0.11
71 0.12
72 0.09
73 0.08
74 0.09
75 0.08
76 0.09
77 0.08
78 0.08
79 0.09
80 0.09
81 0.1
82 0.1
83 0.11
84 0.16
85 0.16
86 0.22
87 0.23
88 0.26
89 0.28
90 0.32
91 0.34
92 0.32
93 0.3
94 0.28
95 0.3
96 0.28
97 0.27
98 0.23
99 0.21
100 0.22
101 0.22
102 0.19
103 0.21
104 0.22
105 0.2
106 0.21
107 0.22
108 0.22
109 0.25
110 0.31
111 0.33
112 0.35
113 0.41
114 0.42
115 0.41
116 0.47
117 0.53
118 0.55
119 0.58
120 0.65
121 0.69
122 0.78
123 0.81
124 0.81
125 0.81
126 0.82
127 0.84
128 0.84
129 0.85
130 0.85
131 0.87
132 0.87
133 0.86
134 0.77
135 0.7
136 0.66
137 0.62
138 0.61
139 0.63
140 0.65
141 0.65
142 0.68
143 0.74
144 0.74
145 0.74
146 0.74
147 0.72
148 0.69
149 0.68
150 0.69