Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0T5J1

Protein Details
Accession A0A0L0T5J1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PAPGCARRTHARSRARRAVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR035647  EFG_III/V  
IPR035649  EFG_V  
IPR000640  EFG_V-like  
Pfam View protein in Pfam  
PF00679  EFG_C  
CDD cd03713  EFG_mtEFG_C  
Amino Acid Sequences MPAPGCARRTHARSRARRAVGNANLTVHTLHVVDAGSPAPSAGAAAAAAASAWLVARMLRQAAGGATINPTATAAGDVAVIHPMMKVSVVAPADKVGAVLRDLHRRSGRVHDVAPMEGVADKQVIACQVPLAEMIGYASALRSLTSGAGTFDMVLDGYDAVMGSSNGGASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.78
4 0.76
5 0.71
6 0.72
7 0.69
8 0.64
9 0.56
10 0.47
11 0.42
12 0.38
13 0.33
14 0.23
15 0.17
16 0.11
17 0.09
18 0.09
19 0.08
20 0.07
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.05
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.04
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.07
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.05
84 0.05
85 0.05
86 0.09
87 0.11
88 0.19
89 0.2
90 0.25
91 0.27
92 0.28
93 0.3
94 0.35
95 0.38
96 0.33
97 0.33
98 0.32
99 0.32
100 0.3
101 0.28
102 0.2
103 0.14
104 0.12
105 0.11
106 0.07
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.08
134 0.08
135 0.09
136 0.09
137 0.08
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.05
150 0.05
151 0.06