Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0S3C6

Protein Details
Accession A0A0L0S3C6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GDERERARLRNLKKQKEQNKGKCKDPTBasic
NLS Segment(s)
PositionSequence
10-24ARLRNLKKQKEQNKG
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGDERERARLRNLKKQKEQNKGKCKDPTSVKKRQESDAEIMRQKQAAALERKEVEAKAAAAAAMAAKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.75
4 0.81
5 0.82
6 0.85
7 0.89
8 0.89
9 0.89
10 0.84
11 0.81
12 0.79
13 0.72
14 0.68
15 0.67
16 0.67
17 0.65
18 0.7
19 0.69
20 0.68
21 0.68
22 0.64
23 0.59
24 0.52
25 0.48
26 0.45
27 0.42
28 0.37
29 0.36
30 0.33
31 0.28
32 0.24
33 0.21
34 0.18
35 0.21
36 0.25
37 0.25
38 0.29
39 0.3
40 0.31
41 0.31
42 0.28
43 0.23
44 0.19
45 0.18
46 0.14
47 0.13
48 0.11
49 0.09
50 0.1
51 0.08
52 0.07