Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T4Y7

Protein Details
Accession A0A0L0T4Y7   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-65ASMARKKLVPPCPPRRLRRSFALHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MTPPPPPIAAPSAERDMADPSAAVLSEPLPGAWPSDVTTTYAASMARKKLVPPCPPRRLRRSFALLGELPEDLHLALLNFVDLDAYVALARSSRYWRTLCSSDAALHPALRRWFGHIPPHFTTSTPTVPQRLSPLSILAHPRARHAGRYIGLALGPRAAAPPRPLDLTLDMGAAGYLACPGGILEWTDDAGARVTATRVGACLVGSTDPLLGSRLVVGVVVAIAEPVWNATGVLRPVRNGRYSGLVANGHAPRAFPQIVIDLRFDAVPRATPPFRAAHPAEGHGGWCVTGRVVLYPADDDDAALSRSQLDVGSAPQFTVPIAGVNVPDAVDEWYLVADVDTWSDARASRPPVIVDGVDHVSAWTRTYAPLLDRIHVVRRGRFLVGYWRYPTLTAFAAEWAGSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.25
5 0.22
6 0.17
7 0.13
8 0.13
9 0.12
10 0.11
11 0.08
12 0.08
13 0.09
14 0.1
15 0.09
16 0.09
17 0.1
18 0.12
19 0.11
20 0.12
21 0.12
22 0.15
23 0.15
24 0.16
25 0.17
26 0.15
27 0.15
28 0.16
29 0.16
30 0.17
31 0.22
32 0.24
33 0.28
34 0.28
35 0.32
36 0.39
37 0.48
38 0.54
39 0.58
40 0.65
41 0.71
42 0.8
43 0.85
44 0.86
45 0.86
46 0.81
47 0.8
48 0.77
49 0.72
50 0.65
51 0.63
52 0.54
53 0.47
54 0.42
55 0.33
56 0.24
57 0.19
58 0.16
59 0.09
60 0.08
61 0.06
62 0.05
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.08
79 0.13
80 0.16
81 0.22
82 0.23
83 0.26
84 0.32
85 0.34
86 0.33
87 0.31
88 0.3
89 0.26
90 0.27
91 0.27
92 0.21
93 0.2
94 0.2
95 0.21
96 0.21
97 0.22
98 0.2
99 0.24
100 0.28
101 0.3
102 0.39
103 0.39
104 0.44
105 0.44
106 0.48
107 0.42
108 0.37
109 0.36
110 0.31
111 0.31
112 0.27
113 0.26
114 0.26
115 0.26
116 0.27
117 0.29
118 0.26
119 0.24
120 0.21
121 0.21
122 0.19
123 0.22
124 0.24
125 0.22
126 0.25
127 0.24
128 0.25
129 0.3
130 0.3
131 0.29
132 0.28
133 0.3
134 0.26
135 0.27
136 0.26
137 0.19
138 0.19
139 0.17
140 0.14
141 0.09
142 0.08
143 0.06
144 0.07
145 0.07
146 0.09
147 0.1
148 0.12
149 0.13
150 0.15
151 0.15
152 0.16
153 0.16
154 0.17
155 0.16
156 0.13
157 0.12
158 0.1
159 0.1
160 0.08
161 0.06
162 0.03
163 0.03
164 0.02
165 0.02
166 0.02
167 0.02
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.06
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.03
215 0.03
216 0.03
217 0.03
218 0.06
219 0.07
220 0.1
221 0.1
222 0.11
223 0.16
224 0.19
225 0.21
226 0.2
227 0.2
228 0.21
229 0.22
230 0.22
231 0.21
232 0.18
233 0.17
234 0.21
235 0.2
236 0.17
237 0.16
238 0.15
239 0.13
240 0.18
241 0.18
242 0.12
243 0.13
244 0.17
245 0.18
246 0.2
247 0.19
248 0.14
249 0.14
250 0.14
251 0.14
252 0.1
253 0.09
254 0.09
255 0.1
256 0.15
257 0.16
258 0.17
259 0.19
260 0.21
261 0.21
262 0.27
263 0.27
264 0.28
265 0.29
266 0.29
267 0.29
268 0.26
269 0.25
270 0.19
271 0.17
272 0.11
273 0.1
274 0.08
275 0.06
276 0.07
277 0.07
278 0.07
279 0.08
280 0.09
281 0.09
282 0.09
283 0.1
284 0.1
285 0.1
286 0.09
287 0.08
288 0.09
289 0.09
290 0.08
291 0.08
292 0.07
293 0.07
294 0.08
295 0.07
296 0.07
297 0.07
298 0.09
299 0.12
300 0.11
301 0.11
302 0.11
303 0.11
304 0.1
305 0.1
306 0.08
307 0.07
308 0.07
309 0.08
310 0.08
311 0.09
312 0.09
313 0.08
314 0.08
315 0.07
316 0.08
317 0.08
318 0.07
319 0.07
320 0.07
321 0.07
322 0.07
323 0.06
324 0.05
325 0.05
326 0.06
327 0.06
328 0.06
329 0.07
330 0.08
331 0.09
332 0.11
333 0.16
334 0.2
335 0.24
336 0.26
337 0.27
338 0.28
339 0.3
340 0.27
341 0.23
342 0.22
343 0.2
344 0.18
345 0.17
346 0.15
347 0.15
348 0.15
349 0.15
350 0.13
351 0.12
352 0.12
353 0.15
354 0.18
355 0.17
356 0.25
357 0.26
358 0.26
359 0.29
360 0.31
361 0.36
362 0.4
363 0.43
364 0.39
365 0.43
366 0.45
367 0.43
368 0.41
369 0.36
370 0.4
371 0.42
372 0.43
373 0.41
374 0.4
375 0.39
376 0.39
377 0.38
378 0.3
379 0.26
380 0.21
381 0.18
382 0.16
383 0.16
384 0.15