Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0S8F1

Protein Details
Accession A0A0L0S8F1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MTKIKKGRKKHGKKGKHGHKKKYGHKKHRLYARQNDDDBasic
NLS Segment(s)
PositionSequence
3-29KIKKGRKKHGKKGKHGHKKKYGHKKHR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTKIKKGRKKHGKKGKHGHKKKYGHKKHRLYARQNDDDGNGGGDDESTQTDTAIEPTPEPTPEPTKEPTETTSEPPEATETLPLWLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.93
5 0.93
6 0.92
7 0.91
8 0.91
9 0.91
10 0.91
11 0.9
12 0.91
13 0.9
14 0.87
15 0.88
16 0.87
17 0.84
18 0.83
19 0.82
20 0.76
21 0.67
22 0.61
23 0.51
24 0.43
25 0.34
26 0.24
27 0.14
28 0.09
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.07
40 0.09
41 0.09
42 0.08
43 0.1
44 0.11
45 0.12
46 0.13
47 0.15
48 0.18
49 0.2
50 0.24
51 0.26
52 0.29
53 0.31
54 0.32
55 0.31
56 0.33
57 0.34
58 0.34
59 0.36
60 0.33
61 0.31
62 0.3
63 0.3
64 0.23
65 0.22
66 0.21
67 0.15