Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T5R4

Protein Details
Accession A0A0L0T5R4   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-38RVCIHRTAPPAKRRHDRIGSRHDHHQLBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, nucl 10.5, cyto_mito 8.833, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR006708  Pex19  
IPR038322  Pex19_C_sf  
Gene Ontology GO:0005777  C:peroxisome  
Pfam View protein in Pfam  
PF04614  Pex19  
Amino Acid Sequences MSRSPPADGYGRVCIHRTAPPAKRRHDRIGSRHDHHQLLPWPSTLSCTPAARVPTLPTRQPAARNLPATPPPAAIMSKQPPSPRPDAHAADLSDDDDLDDDLLAGVLGDLAKPATATATATAKPAPASGAAPSAPTPAAAPAAASAPASDDPLADDLMRELAANMAALMGAGNDGDGDDALQKAMAEMLQGMEGMGLGEPAAAPAPAPTAETGKSFQDRVRRTVDKLQDSDKQAEASQAASAGTGGAEDMDSLMAEMMKQMESLADSSEFESVLEGMMESLMSKDILHEPLKDLAAKYPAYLEANKSALPADEYAKYEKQYALITEICVIYDAGREEEEAKKIVALMTEVQDLGQPPAELLKELAPGTEVDPVTGIPNLPADAMQPPPECNPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.36
4 0.39
5 0.4
6 0.47
7 0.54
8 0.61
9 0.69
10 0.75
11 0.77
12 0.81
13 0.81
14 0.82
15 0.83
16 0.85
17 0.85
18 0.8
19 0.81
20 0.76
21 0.69
22 0.6
23 0.58
24 0.54
25 0.51
26 0.48
27 0.4
28 0.36
29 0.32
30 0.36
31 0.28
32 0.25
33 0.23
34 0.23
35 0.23
36 0.25
37 0.28
38 0.26
39 0.27
40 0.28
41 0.33
42 0.37
43 0.39
44 0.38
45 0.4
46 0.43
47 0.46
48 0.49
49 0.49
50 0.5
51 0.49
52 0.47
53 0.48
54 0.48
55 0.46
56 0.4
57 0.32
58 0.26
59 0.26
60 0.25
61 0.2
62 0.24
63 0.27
64 0.3
65 0.32
66 0.36
67 0.39
68 0.44
69 0.5
70 0.44
71 0.44
72 0.48
73 0.48
74 0.47
75 0.47
76 0.41
77 0.35
78 0.33
79 0.28
80 0.2
81 0.16
82 0.12
83 0.08
84 0.07
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.04
103 0.05
104 0.07
105 0.1
106 0.11
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.09
114 0.09
115 0.09
116 0.1
117 0.1
118 0.1
119 0.11
120 0.11
121 0.1
122 0.09
123 0.09
124 0.07
125 0.08
126 0.07
127 0.07
128 0.06
129 0.07
130 0.07
131 0.06
132 0.05
133 0.06
134 0.07
135 0.08
136 0.07
137 0.06
138 0.07
139 0.08
140 0.08
141 0.06
142 0.06
143 0.05
144 0.06
145 0.06
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.03
189 0.02
190 0.02
191 0.03
192 0.03
193 0.04
194 0.04
195 0.05
196 0.06
197 0.07
198 0.09
199 0.1
200 0.12
201 0.13
202 0.14
203 0.16
204 0.23
205 0.25
206 0.27
207 0.33
208 0.34
209 0.36
210 0.43
211 0.48
212 0.45
213 0.45
214 0.45
215 0.43
216 0.44
217 0.43
218 0.36
219 0.3
220 0.24
221 0.23
222 0.19
223 0.14
224 0.11
225 0.08
226 0.07
227 0.06
228 0.06
229 0.05
230 0.04
231 0.03
232 0.03
233 0.03
234 0.02
235 0.02
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.08
255 0.08
256 0.08
257 0.07
258 0.07
259 0.06
260 0.05
261 0.05
262 0.04
263 0.04
264 0.04
265 0.03
266 0.03
267 0.04
268 0.04
269 0.04
270 0.04
271 0.06
272 0.09
273 0.14
274 0.15
275 0.16
276 0.18
277 0.21
278 0.22
279 0.22
280 0.19
281 0.18
282 0.21
283 0.2
284 0.18
285 0.17
286 0.18
287 0.2
288 0.2
289 0.2
290 0.2
291 0.21
292 0.21
293 0.2
294 0.18
295 0.16
296 0.16
297 0.15
298 0.14
299 0.15
300 0.17
301 0.22
302 0.24
303 0.24
304 0.25
305 0.24
306 0.24
307 0.23
308 0.22
309 0.21
310 0.2
311 0.2
312 0.19
313 0.19
314 0.16
315 0.15
316 0.13
317 0.09
318 0.11
319 0.11
320 0.1
321 0.11
322 0.11
323 0.14
324 0.17
325 0.19
326 0.18
327 0.17
328 0.16
329 0.16
330 0.17
331 0.15
332 0.13
333 0.13
334 0.14
335 0.15
336 0.15
337 0.14
338 0.15
339 0.15
340 0.15
341 0.14
342 0.12
343 0.11
344 0.14
345 0.15
346 0.14
347 0.14
348 0.15
349 0.16
350 0.16
351 0.16
352 0.14
353 0.14
354 0.15
355 0.2
356 0.18
357 0.15
358 0.15
359 0.15
360 0.16
361 0.16
362 0.15
363 0.09
364 0.11
365 0.11
366 0.11
367 0.11
368 0.11
369 0.13
370 0.15
371 0.21
372 0.21
373 0.23