Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SLX5

Protein Details
Accession A0A0L0SLX5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-184RLAARIGRRPKTRWKRGNNNAEIVDHydrophilic
NLS Segment(s)
PositionSequence
164-175RIGRRPKTRWKR
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004018  RPEL_repeat  
Pfam View protein in Pfam  
PF02755  RPEL  
Amino Acid Sequences MSAPSAAPATPAGTVDPPARADRVAALARPAGAVLAHELGKKLSRRADRQDLIQRNIMKGAHMTHFPVSFRGGTHARLRALVDPAKPGLSRVPSAPGPVTAGALAPPAVIPRSISNDPARPPATAAPADLTLPPPLTVQAQGEIDTDSILTPKKEQDLERLAARIGRRPKTRWKRGNNNAEIVDDSFLDKGGCPAMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.18
5 0.19
6 0.2
7 0.18
8 0.18
9 0.17
10 0.22
11 0.21
12 0.19
13 0.19
14 0.19
15 0.19
16 0.18
17 0.16
18 0.1
19 0.08
20 0.08
21 0.08
22 0.09
23 0.1
24 0.1
25 0.11
26 0.12
27 0.17
28 0.19
29 0.22
30 0.27
31 0.34
32 0.41
33 0.49
34 0.58
35 0.55
36 0.61
37 0.67
38 0.66
39 0.62
40 0.6
41 0.53
42 0.44
43 0.44
44 0.36
45 0.27
46 0.21
47 0.2
48 0.17
49 0.16
50 0.17
51 0.16
52 0.18
53 0.17
54 0.17
55 0.16
56 0.14
57 0.14
58 0.16
59 0.16
60 0.17
61 0.22
62 0.24
63 0.23
64 0.23
65 0.24
66 0.22
67 0.24
68 0.24
69 0.2
70 0.18
71 0.18
72 0.19
73 0.17
74 0.16
75 0.15
76 0.14
77 0.14
78 0.13
79 0.16
80 0.15
81 0.16
82 0.16
83 0.13
84 0.12
85 0.11
86 0.11
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.12
100 0.13
101 0.17
102 0.19
103 0.23
104 0.24
105 0.29
106 0.29
107 0.23
108 0.24
109 0.22
110 0.23
111 0.2
112 0.19
113 0.15
114 0.14
115 0.15
116 0.13
117 0.13
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.1
125 0.1
126 0.12
127 0.12
128 0.12
129 0.12
130 0.12
131 0.11
132 0.1
133 0.09
134 0.06
135 0.07
136 0.08
137 0.08
138 0.09
139 0.12
140 0.16
141 0.2
142 0.22
143 0.29
144 0.34
145 0.36
146 0.37
147 0.36
148 0.32
149 0.31
150 0.31
151 0.31
152 0.33
153 0.38
154 0.43
155 0.47
156 0.58
157 0.66
158 0.76
159 0.79
160 0.81
161 0.84
162 0.88
163 0.93
164 0.89
165 0.84
166 0.75
167 0.66
168 0.57
169 0.47
170 0.38
171 0.27
172 0.21
173 0.14
174 0.13
175 0.12
176 0.09
177 0.09