Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SY07

Protein Details
Accession A0A0L0SY07    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-118FPSCINSLKASKKKREQWNLKHDTMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9.5, cyto 3.5, plas 3, extr 3
Family & Domain DBs
Amino Acid Sequences MAICSSLVRSRKFAFCANMMSHSFLVLFWCSDNTSSNTPVRRWVGSFVGFHSGSARVRSRRSPCGACWLKCWAALVGPASAIAIPRRELDCRFPSCINSLKASKKKREQWNLKHDTMSTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.42
4 0.39
5 0.4
6 0.36
7 0.35
8 0.3
9 0.25
10 0.22
11 0.17
12 0.16
13 0.12
14 0.11
15 0.08
16 0.09
17 0.1
18 0.1
19 0.13
20 0.14
21 0.17
22 0.2
23 0.24
24 0.26
25 0.26
26 0.31
27 0.31
28 0.29
29 0.27
30 0.27
31 0.26
32 0.26
33 0.26
34 0.21
35 0.23
36 0.21
37 0.2
38 0.18
39 0.17
40 0.14
41 0.17
42 0.2
43 0.18
44 0.21
45 0.28
46 0.32
47 0.37
48 0.41
49 0.4
50 0.37
51 0.45
52 0.49
53 0.43
54 0.4
55 0.38
56 0.34
57 0.32
58 0.32
59 0.21
60 0.15
61 0.16
62 0.15
63 0.1
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.11
73 0.13
74 0.16
75 0.18
76 0.25
77 0.31
78 0.33
79 0.37
80 0.35
81 0.36
82 0.37
83 0.42
84 0.37
85 0.35
86 0.37
87 0.43
88 0.51
89 0.58
90 0.64
91 0.67
92 0.75
93 0.8
94 0.85
95 0.87
96 0.88
97 0.91
98 0.89
99 0.82
100 0.76
101 0.65