Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SE24

Protein Details
Accession A0A0L0SE24    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKVKWTKAFRKAAGKEBasic
NLS Segment(s)
PositionSequence
5-16PRKVKWTKAFRK
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKVKWTKAFRKAAGKEMVVDGALDMERRRNVPLRYDRNLMMTTLTAMKKISEIRAKRERVFYKSRVISKKRTAEKTAMLKHVKMNMELVPTATRKRLEESKVLGQKVQNEDIEMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.78
4 0.75
5 0.7
6 0.6
7 0.51
8 0.44
9 0.38
10 0.27
11 0.23
12 0.15
13 0.1
14 0.09
15 0.08
16 0.07
17 0.1
18 0.12
19 0.13
20 0.17
21 0.22
22 0.24
23 0.32
24 0.42
25 0.46
26 0.5
27 0.52
28 0.49
29 0.47
30 0.45
31 0.36
32 0.26
33 0.18
34 0.15
35 0.16
36 0.15
37 0.12
38 0.11
39 0.11
40 0.12
41 0.14
42 0.18
43 0.21
44 0.23
45 0.3
46 0.38
47 0.42
48 0.42
49 0.5
50 0.49
51 0.47
52 0.52
53 0.47
54 0.47
55 0.5
56 0.54
57 0.55
58 0.56
59 0.57
60 0.59
61 0.65
62 0.65
63 0.65
64 0.62
65 0.57
66 0.6
67 0.61
68 0.58
69 0.57
70 0.51
71 0.47
72 0.46
73 0.48
74 0.42
75 0.34
76 0.3
77 0.24
78 0.24
79 0.23
80 0.21
81 0.18
82 0.19
83 0.21
84 0.22
85 0.23
86 0.22
87 0.28
88 0.34
89 0.36
90 0.41
91 0.45
92 0.51
93 0.56
94 0.55
95 0.52
96 0.47
97 0.5
98 0.49
99 0.48
100 0.38