Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SDU0

Protein Details
Accession A0A0L0SDU0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-101VPLVGRGRSPRRCRRERERTPTRVRSSPAHydrophilic
NLS Segment(s)
PositionSequence
80-89RSPRRCRRER
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MRGPRLLLPRRHGTCLTCRLARAPDDDDEGDDDGSGTATPRPLTRTPARHGVVGAIKTAAADGQPRARVGGWVPLVGRGRSPRRCRRERERTPTRVRSSPAVTPVAHNDRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.55
4 0.47
5 0.44
6 0.42
7 0.43
8 0.41
9 0.36
10 0.31
11 0.27
12 0.29
13 0.28
14 0.25
15 0.23
16 0.22
17 0.17
18 0.14
19 0.12
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.06
26 0.07
27 0.08
28 0.13
29 0.14
30 0.21
31 0.27
32 0.32
33 0.35
34 0.43
35 0.43
36 0.39
37 0.38
38 0.34
39 0.3
40 0.25
41 0.21
42 0.12
43 0.11
44 0.1
45 0.1
46 0.07
47 0.04
48 0.05
49 0.06
50 0.09
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.17
58 0.15
59 0.15
60 0.15
61 0.19
62 0.21
63 0.2
64 0.22
65 0.23
66 0.31
67 0.4
68 0.5
69 0.55
70 0.64
71 0.72
72 0.79
73 0.83
74 0.85
75 0.87
76 0.88
77 0.88
78 0.88
79 0.9
80 0.91
81 0.86
82 0.81
83 0.74
84 0.7
85 0.64
86 0.6
87 0.55
88 0.49
89 0.43
90 0.4
91 0.45