Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S6M7

Protein Details
Accession A0A0L0S6M7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-131GLAEESKSGRKQRKERKNRAKKVRGTKKAAIMGKBasic
NLS Segment(s)
PositionSequence
100-132AEESKSGRKQRKERKNRAKKVRGTKKAAIMGKK
Subcellular Location(s) mito 14.5, mito_nucl 10.333, cyto 7.5, cyto_nucl 6.833, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAIDTSSATIRTRKFLTNRLLQRKQMVVDVLHANLANLAKETIREKLAKMYKVNKEVVVVFGFRTAFGGGKSTGFALIYDSVDSLKKFEPKHRLVRLGLAEESKSGRKQRKERKNRAKKVRGTKKAAIMGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.5
4 0.55
5 0.63
6 0.69
7 0.72
8 0.68
9 0.67
10 0.63
11 0.56
12 0.49
13 0.42
14 0.32
15 0.29
16 0.28
17 0.23
18 0.2
19 0.18
20 0.15
21 0.14
22 0.14
23 0.09
24 0.08
25 0.08
26 0.07
27 0.09
28 0.11
29 0.11
30 0.14
31 0.15
32 0.15
33 0.23
34 0.29
35 0.32
36 0.35
37 0.41
38 0.44
39 0.48
40 0.49
41 0.41
42 0.37
43 0.33
44 0.3
45 0.22
46 0.16
47 0.11
48 0.11
49 0.1
50 0.09
51 0.09
52 0.07
53 0.06
54 0.06
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.09
71 0.09
72 0.11
73 0.16
74 0.18
75 0.25
76 0.34
77 0.4
78 0.5
79 0.55
80 0.57
81 0.53
82 0.58
83 0.54
84 0.47
85 0.42
86 0.34
87 0.28
88 0.23
89 0.25
90 0.22
91 0.24
92 0.28
93 0.35
94 0.43
95 0.54
96 0.64
97 0.72
98 0.8
99 0.87
100 0.91
101 0.94
102 0.95
103 0.96
104 0.95
105 0.94
106 0.94
107 0.93
108 0.92
109 0.89
110 0.86
111 0.83
112 0.82