Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0T9M7

Protein Details
Accession A0A0L0T9M7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
120-149ELRCIKTIQRWWRRVRRQRAHEPRKRVEKPBasic
NLS Segment(s)
PositionSequence
132-145RRVRRQRAHEPRKR
Subcellular Location(s) nucl 16, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
Pfam View protein in Pfam  
PF00612  IQ  
Amino Acid Sequences MDSEQHECVRDQSIPLLAYRDRRPPTTTLDASNEAPAPTNAEIPLVVIRVRAATLIQRWFRRWLVHRRAVKRARVYRLVQAEAELRTRLTTLDAHMTRRLGHLQLLQDGGDAGGLALEWELRCIKTIQRWWRRVRRQRAHEPRKRVEKPVVDALPAVVVDQARVDEYVRALDETLTPAPSTRRELPAENLRELRILRRMYQTQYRLLTDGSAVSDRQAHGKTFAELVPQYRRAAARYQRERDKMRELVEVAKTGLTSTYSVWQHNQDITETHTLFVQARDLNCVERHAVLTTTVDRRPRFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.25
5 0.3
6 0.34
7 0.4
8 0.4
9 0.43
10 0.46
11 0.45
12 0.5
13 0.52
14 0.5
15 0.46
16 0.47
17 0.47
18 0.44
19 0.43
20 0.36
21 0.27
22 0.26
23 0.21
24 0.2
25 0.17
26 0.18
27 0.15
28 0.14
29 0.14
30 0.13
31 0.14
32 0.11
33 0.11
34 0.09
35 0.09
36 0.09
37 0.1
38 0.09
39 0.08
40 0.12
41 0.17
42 0.24
43 0.3
44 0.33
45 0.36
46 0.41
47 0.43
48 0.46
49 0.49
50 0.53
51 0.57
52 0.62
53 0.69
54 0.7
55 0.78
56 0.77
57 0.77
58 0.76
59 0.74
60 0.73
61 0.71
62 0.68
63 0.65
64 0.63
65 0.57
66 0.46
67 0.39
68 0.35
69 0.29
70 0.28
71 0.2
72 0.15
73 0.13
74 0.13
75 0.12
76 0.11
77 0.1
78 0.1
79 0.19
80 0.2
81 0.23
82 0.25
83 0.25
84 0.24
85 0.25
86 0.25
87 0.17
88 0.18
89 0.19
90 0.18
91 0.19
92 0.19
93 0.17
94 0.14
95 0.13
96 0.11
97 0.07
98 0.05
99 0.03
100 0.02
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.04
107 0.05
108 0.05
109 0.07
110 0.08
111 0.1
112 0.16
113 0.25
114 0.34
115 0.43
116 0.52
117 0.6
118 0.7
119 0.78
120 0.82
121 0.85
122 0.85
123 0.84
124 0.87
125 0.9
126 0.9
127 0.87
128 0.86
129 0.82
130 0.83
131 0.77
132 0.7
133 0.66
134 0.59
135 0.55
136 0.53
137 0.46
138 0.36
139 0.33
140 0.28
141 0.21
142 0.16
143 0.12
144 0.05
145 0.05
146 0.04
147 0.04
148 0.05
149 0.04
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.07
160 0.09
161 0.09
162 0.09
163 0.08
164 0.09
165 0.11
166 0.13
167 0.17
168 0.18
169 0.22
170 0.24
171 0.26
172 0.32
173 0.39
174 0.4
175 0.38
176 0.36
177 0.32
178 0.31
179 0.3
180 0.27
181 0.25
182 0.23
183 0.23
184 0.28
185 0.31
186 0.34
187 0.42
188 0.42
189 0.41
190 0.42
191 0.4
192 0.34
193 0.31
194 0.27
195 0.19
196 0.17
197 0.13
198 0.11
199 0.1
200 0.09
201 0.11
202 0.11
203 0.15
204 0.17
205 0.16
206 0.17
207 0.19
208 0.19
209 0.19
210 0.19
211 0.19
212 0.18
213 0.21
214 0.25
215 0.26
216 0.26
217 0.27
218 0.28
219 0.26
220 0.34
221 0.38
222 0.43
223 0.5
224 0.58
225 0.63
226 0.7
227 0.74
228 0.71
229 0.71
230 0.65
231 0.58
232 0.55
233 0.48
234 0.46
235 0.43
236 0.38
237 0.31
238 0.26
239 0.23
240 0.18
241 0.17
242 0.12
243 0.1
244 0.1
245 0.17
246 0.19
247 0.21
248 0.24
249 0.27
250 0.29
251 0.31
252 0.3
253 0.25
254 0.24
255 0.26
256 0.31
257 0.28
258 0.24
259 0.22
260 0.23
261 0.22
262 0.22
263 0.22
264 0.18
265 0.18
266 0.23
267 0.24
268 0.26
269 0.26
270 0.28
271 0.25
272 0.23
273 0.24
274 0.21
275 0.2
276 0.18
277 0.21
278 0.24
279 0.28
280 0.31
281 0.37