Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W042

Protein Details
Accession B2W042    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-42LEELNKKRSKKQGEKLDKELEBasic
NLS Segment(s)
PositionSequence
28-32KRSKK
Subcellular Location(s) cyto 10, cyto_nucl 9.333, nucl 7.5, cyto_pero 6.833, mito 4, pero 2.5
Family & Domain DBs
Amino Acid Sequences MLDEELKEKLETELEVELEAKLEELNKKRSKKQGEKLDKELEAKSGKELEENLEEKNEGEAGAGAGVQYLQEWPNWTGVFDDQGDQRDTKGDVVPQELGIVCAFAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.11
5 0.1
6 0.1
7 0.07
8 0.06
9 0.09
10 0.15
11 0.19
12 0.29
13 0.36
14 0.42
15 0.49
16 0.58
17 0.66
18 0.7
19 0.75
20 0.76
21 0.8
22 0.81
23 0.81
24 0.77
25 0.69
26 0.61
27 0.51
28 0.44
29 0.35
30 0.28
31 0.23
32 0.19
33 0.17
34 0.15
35 0.15
36 0.13
37 0.16
38 0.16
39 0.15
40 0.13
41 0.13
42 0.13
43 0.13
44 0.1
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.08
60 0.09
61 0.12
62 0.13
63 0.13
64 0.13
65 0.13
66 0.15
67 0.13
68 0.14
69 0.13
70 0.16
71 0.18
72 0.17
73 0.17
74 0.17
75 0.17
76 0.18
77 0.18
78 0.18
79 0.18
80 0.22
81 0.22
82 0.2
83 0.21
84 0.19
85 0.17
86 0.14