Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SQ35

Protein Details
Accession A0A0L0SQ35   
Localization Confidence High
Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-100LSKGHSCYRPRRTGERKRKSVRGCBasic
183-202TPLTLQRKRHYNAEKRRRAVHydrophilic
213-238KLLASRQKEARDKKHALKLQRRSSASHydrophilic
NLS Segment(s)
PositionSequence
89-95TGERKRK
131-143KRLGPKRASKIRK
155-234KYVIRREVPSKKEGKPAKSKAPKIQRLVTPLTLQRKRHYNAEKRRRAVASREAAADYKKLLASRQKEARDKKHALKLQRR
Subcellular Location(s) nucl 19.5, cyto_nucl 14.333, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNIADPSTGSQKTIEIEDEKKVHVLMDKRISAEVPGDQLGDEFKGYVFKITGGNDKQGFPMKQGVLVPSRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVSSDISVVSLVVVKKGEADLPGITDVTVPKRLGPKRASKIRKMFNLTKEDDVRKYVIRREVPSKKEGKPAKSKAPKIQRLVTPLTLQRKRHYNAEKRRRAVASREAAADYKKLLASRQKEARDKKHALKLQRRSSASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.21
5 0.23
6 0.29
7 0.3
8 0.29
9 0.29
10 0.27
11 0.24
12 0.25
13 0.27
14 0.29
15 0.35
16 0.36
17 0.37
18 0.37
19 0.36
20 0.31
21 0.29
22 0.22
23 0.16
24 0.15
25 0.14
26 0.13
27 0.13
28 0.12
29 0.11
30 0.09
31 0.07
32 0.07
33 0.09
34 0.09
35 0.1
36 0.1
37 0.1
38 0.13
39 0.15
40 0.23
41 0.23
42 0.28
43 0.29
44 0.29
45 0.3
46 0.34
47 0.33
48 0.27
49 0.31
50 0.26
51 0.27
52 0.27
53 0.27
54 0.23
55 0.26
56 0.25
57 0.2
58 0.21
59 0.18
60 0.18
61 0.16
62 0.17
63 0.2
64 0.23
65 0.27
66 0.28
67 0.32
68 0.36
69 0.4
70 0.46
71 0.49
72 0.52
73 0.52
74 0.6
75 0.67
76 0.74
77 0.8
78 0.81
79 0.83
80 0.81
81 0.85
82 0.8
83 0.79
84 0.75
85 0.7
86 0.6
87 0.52
88 0.48
89 0.4
90 0.35
91 0.26
92 0.18
93 0.11
94 0.1
95 0.07
96 0.04
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.06
106 0.07
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.07
114 0.08
115 0.11
116 0.1
117 0.12
118 0.2
119 0.22
120 0.29
121 0.34
122 0.41
123 0.47
124 0.58
125 0.62
126 0.63
127 0.69
128 0.69
129 0.71
130 0.69
131 0.67
132 0.63
133 0.64
134 0.58
135 0.55
136 0.52
137 0.48
138 0.42
139 0.38
140 0.33
141 0.29
142 0.3
143 0.3
144 0.33
145 0.34
146 0.37
147 0.44
148 0.51
149 0.51
150 0.56
151 0.58
152 0.54
153 0.58
154 0.61
155 0.59
156 0.61
157 0.64
158 0.67
159 0.7
160 0.74
161 0.74
162 0.78
163 0.79
164 0.74
165 0.75
166 0.68
167 0.64
168 0.62
169 0.55
170 0.49
171 0.46
172 0.51
173 0.5
174 0.49
175 0.5
176 0.54
177 0.54
178 0.59
179 0.63
180 0.64
181 0.68
182 0.76
183 0.8
184 0.75
185 0.79
186 0.74
187 0.68
188 0.65
189 0.64
190 0.6
191 0.53
192 0.51
193 0.46
194 0.43
195 0.4
196 0.33
197 0.25
198 0.2
199 0.19
200 0.18
201 0.22
202 0.29
203 0.33
204 0.41
205 0.49
206 0.55
207 0.63
208 0.72
209 0.76
210 0.77
211 0.8
212 0.79
213 0.81
214 0.79
215 0.8
216 0.81
217 0.82
218 0.82
219 0.83