Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SCU5

Protein Details
Accession A0A0L0SCU5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MMVPSKKRRGSGRRRSSFFHHydrophilic
NLS Segment(s)
PositionSequence
6-15KKRRGSGRRR
Subcellular Location(s) plas 12, mito 10, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMVPSKKRRGSGRRRSSFFHPLENPLTGPLFLWVVGDPKRKWIAPVLAMISVSATFVWLALPLVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.76
4 0.75
5 0.66
6 0.63
7 0.54
8 0.49
9 0.48
10 0.44
11 0.36
12 0.27
13 0.26
14 0.17
15 0.15
16 0.1
17 0.08
18 0.07
19 0.07
20 0.05
21 0.08
22 0.11
23 0.17
24 0.16
25 0.21
26 0.24
27 0.23
28 0.24
29 0.28
30 0.29
31 0.26
32 0.3
33 0.26
34 0.25
35 0.24
36 0.23
37 0.18
38 0.13
39 0.11
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05