Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SR04

Protein Details
Accession A0A0L0SR04    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-114AIRTEPRRPDEPNKKNRRRVBasic
NLS Segment(s)
PositionSequence
103-114PDEPNKKNRRRV
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039907  NOB1  
IPR033411  Ribonuclease_PIN  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
Pfam View protein in Pfam  
PF17146  PIN_6  
CDD cd09876  PIN_Nob1-like  
Amino Acid Sequences MTNPPAPNPSHKTRILVLDTAPLIKQIPLYHVAERFITIPDVLNEVRDERAREYLMRLPFRIETRTGDFPSLSLVDLRVLALTGMLNWEEDGLDAIRTEPRRPDEPNKKNRRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.42
4 0.35
5 0.33
6 0.31
7 0.28
8 0.24
9 0.18
10 0.15
11 0.13
12 0.15
13 0.11
14 0.13
15 0.16
16 0.19
17 0.21
18 0.22
19 0.22
20 0.2
21 0.21
22 0.19
23 0.15
24 0.13
25 0.1
26 0.1
27 0.09
28 0.12
29 0.11
30 0.11
31 0.1
32 0.11
33 0.12
34 0.13
35 0.14
36 0.12
37 0.15
38 0.15
39 0.15
40 0.17
41 0.21
42 0.25
43 0.25
44 0.24
45 0.23
46 0.24
47 0.25
48 0.24
49 0.2
50 0.18
51 0.21
52 0.25
53 0.25
54 0.24
55 0.22
56 0.2
57 0.2
58 0.17
59 0.13
60 0.08
61 0.08
62 0.07
63 0.08
64 0.08
65 0.06
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.07
79 0.06
80 0.06
81 0.06
82 0.07
83 0.13
84 0.15
85 0.17
86 0.22
87 0.27
88 0.33
89 0.4
90 0.5
91 0.56
92 0.65
93 0.74
94 0.79