Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0T7H5

Protein Details
Accession A0A0L0T7H5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
164-192ATTPVELPKKRKCHRRRRHPKTTIVIEHPBasic
NLS Segment(s)
PositionSequence
172-184KKRKCHRRRRHPK
Subcellular Location(s) cyto 18.5, cyto_nucl 11.833, mito_nucl 4.333, nucl 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSSFLISSLIFRDGTIVGTVPVVPTTVPVVPESPVKTEPCVETIIATPSSTPVAPESPVKTEPCVETVIATPTPVVPESPVQTTPAEPCVETVIATTTPTPAAPESPVETQPDCTETVIVTPTPVVPESPAETTLCEQPAVTSTVEVPVAYSTTTVPSDELPVATTPVELPKKRKCHRRRRHPKTTIVIEHPAETYPSTVIVTEVPVATTPVVIFHDDGAVGPKEPIATTPADESYGGARDARGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.1
5 0.1
6 0.11
7 0.09
8 0.08
9 0.07
10 0.06
11 0.07
12 0.1
13 0.11
14 0.11
15 0.12
16 0.13
17 0.14
18 0.19
19 0.2
20 0.21
21 0.24
22 0.24
23 0.25
24 0.27
25 0.28
26 0.25
27 0.25
28 0.21
29 0.18
30 0.18
31 0.2
32 0.17
33 0.16
34 0.14
35 0.13
36 0.14
37 0.13
38 0.12
39 0.1
40 0.11
41 0.13
42 0.17
43 0.18
44 0.21
45 0.24
46 0.25
47 0.24
48 0.26
49 0.26
50 0.24
51 0.23
52 0.18
53 0.16
54 0.16
55 0.18
56 0.15
57 0.14
58 0.12
59 0.1
60 0.12
61 0.11
62 0.1
63 0.08
64 0.1
65 0.12
66 0.15
67 0.15
68 0.15
69 0.16
70 0.17
71 0.16
72 0.17
73 0.16
74 0.13
75 0.13
76 0.13
77 0.13
78 0.12
79 0.1
80 0.09
81 0.08
82 0.09
83 0.09
84 0.07
85 0.07
86 0.07
87 0.08
88 0.06
89 0.07
90 0.08
91 0.09
92 0.11
93 0.13
94 0.14
95 0.15
96 0.15
97 0.15
98 0.15
99 0.15
100 0.13
101 0.11
102 0.1
103 0.08
104 0.08
105 0.08
106 0.07
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.05
113 0.05
114 0.06
115 0.08
116 0.09
117 0.09
118 0.09
119 0.1
120 0.11
121 0.12
122 0.12
123 0.1
124 0.09
125 0.08
126 0.09
127 0.11
128 0.1
129 0.08
130 0.08
131 0.09
132 0.09
133 0.08
134 0.07
135 0.05
136 0.06
137 0.05
138 0.06
139 0.05
140 0.07
141 0.07
142 0.07
143 0.08
144 0.08
145 0.1
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.09
152 0.09
153 0.07
154 0.14
155 0.2
156 0.22
157 0.28
158 0.36
159 0.47
160 0.55
161 0.65
162 0.69
163 0.74
164 0.83
165 0.88
166 0.91
167 0.91
168 0.95
169 0.93
170 0.92
171 0.89
172 0.88
173 0.83
174 0.77
175 0.72
176 0.61
177 0.54
178 0.45
179 0.36
180 0.27
181 0.2
182 0.16
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.09
190 0.09
191 0.09
192 0.08
193 0.08
194 0.09
195 0.09
196 0.08
197 0.07
198 0.08
199 0.09
200 0.1
201 0.1
202 0.1
203 0.1
204 0.1
205 0.1
206 0.13
207 0.12
208 0.12
209 0.11
210 0.12
211 0.12
212 0.12
213 0.13
214 0.12
215 0.12
216 0.13
217 0.16
218 0.17
219 0.18
220 0.18
221 0.17
222 0.18
223 0.18
224 0.17
225 0.15
226 0.14