Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SKT2

Protein Details
Accession A0A0L0SKT2    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
211-234DEDGTREKKKTKRKGLTEEEVRHKBasic
NLS Segment(s)
PositionSequence
24-24K
32-46PSNARPKRPVAAKIK
217-225EKKKTKRKG
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPPKSFNNNNNKSRSRGGPHAAGKPTGASDAPSNARPKRPVAAKIKAGTSMRKSVTQLRSEIRGLERLLNKKRDTLNAQARSDMERKLAALKFQLDRTQTLQRDAAKVEKFEAMYRAVKFVERVKATRTVRKLQRKLEAGEEVQQKLNDAMLDVCYVMHFPPATKYYALYKTPEGKEAEMARDEIRDQIRSLVESGAIDKEATVARCLGLDEDGTREKKKTKRKGLTEEEVRHKALGNMLRGVKVEKKGAAGVDETIESEAKPINDDFFMADDSSDDDDESDGEEEAVPAARGKKKAAAASSASSSDTSSSDGSDSDDDMSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.64
4 0.61
5 0.61
6 0.64
7 0.66
8 0.63
9 0.56
10 0.49
11 0.41
12 0.36
13 0.29
14 0.23
15 0.17
16 0.16
17 0.2
18 0.23
19 0.27
20 0.33
21 0.36
22 0.42
23 0.44
24 0.45
25 0.48
26 0.52
27 0.57
28 0.59
29 0.62
30 0.64
31 0.64
32 0.62
33 0.6
34 0.55
35 0.53
36 0.49
37 0.48
38 0.42
39 0.42
40 0.43
41 0.46
42 0.51
43 0.48
44 0.48
45 0.44
46 0.46
47 0.43
48 0.44
49 0.37
50 0.34
51 0.31
52 0.33
53 0.36
54 0.41
55 0.48
56 0.52
57 0.5
58 0.53
59 0.55
60 0.55
61 0.54
62 0.55
63 0.57
64 0.58
65 0.57
66 0.53
67 0.5
68 0.48
69 0.45
70 0.36
71 0.28
72 0.2
73 0.2
74 0.24
75 0.24
76 0.21
77 0.22
78 0.25
79 0.26
80 0.27
81 0.31
82 0.26
83 0.27
84 0.3
85 0.35
86 0.32
87 0.33
88 0.34
89 0.32
90 0.32
91 0.32
92 0.34
93 0.27
94 0.27
95 0.25
96 0.24
97 0.22
98 0.21
99 0.22
100 0.18
101 0.2
102 0.2
103 0.2
104 0.18
105 0.18
106 0.19
107 0.21
108 0.25
109 0.24
110 0.25
111 0.26
112 0.34
113 0.37
114 0.42
115 0.43
116 0.45
117 0.52
118 0.61
119 0.65
120 0.63
121 0.67
122 0.64
123 0.61
124 0.56
125 0.5
126 0.4
127 0.4
128 0.37
129 0.3
130 0.28
131 0.26
132 0.21
133 0.18
134 0.17
135 0.1
136 0.07
137 0.06
138 0.05
139 0.06
140 0.05
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.08
149 0.1
150 0.11
151 0.11
152 0.12
153 0.16
154 0.21
155 0.22
156 0.21
157 0.23
158 0.29
159 0.29
160 0.33
161 0.29
162 0.25
163 0.27
164 0.27
165 0.26
166 0.19
167 0.2
168 0.15
169 0.15
170 0.15
171 0.15
172 0.15
173 0.14
174 0.13
175 0.15
176 0.15
177 0.15
178 0.16
179 0.12
180 0.11
181 0.1
182 0.11
183 0.08
184 0.08
185 0.07
186 0.06
187 0.07
188 0.09
189 0.09
190 0.09
191 0.08
192 0.08
193 0.09
194 0.09
195 0.08
196 0.07
197 0.07
198 0.06
199 0.1
200 0.14
201 0.16
202 0.17
203 0.19
204 0.26
205 0.33
206 0.43
207 0.51
208 0.58
209 0.65
210 0.74
211 0.82
212 0.83
213 0.86
214 0.85
215 0.82
216 0.79
217 0.72
218 0.63
219 0.53
220 0.45
221 0.36
222 0.32
223 0.29
224 0.24
225 0.25
226 0.26
227 0.27
228 0.27
229 0.28
230 0.28
231 0.26
232 0.27
233 0.23
234 0.24
235 0.25
236 0.25
237 0.23
238 0.19
239 0.16
240 0.14
241 0.13
242 0.12
243 0.11
244 0.11
245 0.09
246 0.09
247 0.1
248 0.09
249 0.11
250 0.11
251 0.12
252 0.12
253 0.13
254 0.13
255 0.12
256 0.13
257 0.11
258 0.1
259 0.09
260 0.11
261 0.12
262 0.12
263 0.1
264 0.09
265 0.09
266 0.09
267 0.11
268 0.09
269 0.07
270 0.08
271 0.08
272 0.07
273 0.08
274 0.09
275 0.07
276 0.09
277 0.15
278 0.21
279 0.23
280 0.26
281 0.31
282 0.36
283 0.42
284 0.43
285 0.42
286 0.41
287 0.42
288 0.43
289 0.38
290 0.33
291 0.28
292 0.25
293 0.21
294 0.17
295 0.16
296 0.13
297 0.13
298 0.13
299 0.13
300 0.15
301 0.15
302 0.15