Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0RVW7

Protein Details
Accession A0A0L0RVW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
139-173ASKRKHKGGKGRKLKGKSRKSRKHKGGKAQGRGQGBasic
NLS Segment(s)
PositionSequence
141-170KRKHKGGKGRKLKGKSRKSRKHKGGKAQGR
Subcellular Location(s) cyto 9, mito 8, extr 6, pero 2
Family & Domain DBs
Amino Acid Sequences MTRVLILHLALAATTPAARGAAFVAPDADAVDLTKRGGKWDYGGGKGDYGNNKYKGDHGKGKYGGDYGKGKYKGDYSKNDVAEGKSGKKDERDYSKKDLAEGETHVERDRRDMAGDATADSGEIADSDEIADGGEIDDASKRKHKGGKGRKLKGKSRKSRKHKGGKAQGRGQGEDLPGSAYPGKGKYGVKPQPSPQPSPEPAPSPEPAPSPEPSPGPDGGNGNNGTGGNGRNGPAGRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.08
8 0.1
9 0.1
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.08
16 0.06
17 0.07
18 0.08
19 0.08
20 0.09
21 0.13
22 0.12
23 0.15
24 0.18
25 0.18
26 0.19
27 0.27
28 0.3
29 0.29
30 0.33
31 0.3
32 0.29
33 0.29
34 0.31
35 0.29
36 0.29
37 0.34
38 0.34
39 0.34
40 0.34
41 0.39
42 0.42
43 0.44
44 0.48
45 0.44
46 0.49
47 0.5
48 0.51
49 0.46
50 0.4
51 0.34
52 0.3
53 0.31
54 0.25
55 0.3
56 0.31
57 0.3
58 0.29
59 0.34
60 0.37
61 0.4
62 0.44
63 0.43
64 0.49
65 0.49
66 0.49
67 0.45
68 0.37
69 0.36
70 0.32
71 0.28
72 0.23
73 0.25
74 0.24
75 0.26
76 0.3
77 0.32
78 0.4
79 0.43
80 0.46
81 0.51
82 0.55
83 0.51
84 0.48
85 0.43
86 0.35
87 0.3
88 0.26
89 0.22
90 0.17
91 0.17
92 0.18
93 0.17
94 0.15
95 0.16
96 0.16
97 0.13
98 0.13
99 0.14
100 0.13
101 0.14
102 0.14
103 0.11
104 0.09
105 0.09
106 0.08
107 0.07
108 0.06
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.05
125 0.06
126 0.08
127 0.14
128 0.15
129 0.2
130 0.25
131 0.31
132 0.4
133 0.5
134 0.59
135 0.65
136 0.73
137 0.77
138 0.79
139 0.83
140 0.83
141 0.83
142 0.83
143 0.84
144 0.85
145 0.87
146 0.9
147 0.91
148 0.92
149 0.89
150 0.89
151 0.89
152 0.88
153 0.86
154 0.83
155 0.78
156 0.69
157 0.62
158 0.53
159 0.45
160 0.36
161 0.28
162 0.21
163 0.16
164 0.13
165 0.14
166 0.13
167 0.1
168 0.11
169 0.12
170 0.13
171 0.17
172 0.19
173 0.22
174 0.32
175 0.39
176 0.44
177 0.48
178 0.52
179 0.58
180 0.62
181 0.61
182 0.56
183 0.57
184 0.53
185 0.54
186 0.53
187 0.47
188 0.45
189 0.44
190 0.4
191 0.34
192 0.33
193 0.29
194 0.29
195 0.28
196 0.27
197 0.26
198 0.28
199 0.27
200 0.27
201 0.28
202 0.27
203 0.25
204 0.27
205 0.26
206 0.24
207 0.29
208 0.28
209 0.24
210 0.24
211 0.22
212 0.2
213 0.2
214 0.19
215 0.16
216 0.17
217 0.18
218 0.21