Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0S553

Protein Details
Accession A0A0L0S553    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-68SRSAWKGVDRSWRRRRGRCRRRRRRRRRRSRRGTYSRGRRWPSRRRRGRAERRGCRCRRAVBasic
NLS Segment(s)
PositionSequence
9-63RSAWKGVDRSWRRRRGRCRRRRRRRRRRSRRGTYSRGRRWPSRRRRGRAERRGCR
Subcellular Location(s) plas 21, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTRIGRSRSAWKGVDRSWRRRRGRCRRRRRRRRRRSRRGTYSRGRRWPSRRRRGRAERRGCRCRRAVGHLGGAVRRKVRICVGFDVGVWAGCVGLVVSVCRFGSVCSLRLAIFFFFFWVLCSSPPFPSRIHIRLVVGLCVRDCRRLLGVSSRKCESEVAVSFRVWDSTGARVHASETRSVVHVWRTRRAACPSAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.63
4 0.67
5 0.7
6 0.76
7 0.8
8 0.83
9 0.89
10 0.89
11 0.91
12 0.92
13 0.93
14 0.94
15 0.96
16 0.97
17 0.97
18 0.97
19 0.97
20 0.98
21 0.98
22 0.98
23 0.98
24 0.97
25 0.97
26 0.96
27 0.94
28 0.94
29 0.93
30 0.92
31 0.9
32 0.85
33 0.83
34 0.83
35 0.84
36 0.84
37 0.84
38 0.85
39 0.84
40 0.88
41 0.9
42 0.92
43 0.92
44 0.91
45 0.9
46 0.9
47 0.92
48 0.86
49 0.82
50 0.74
51 0.71
52 0.65
53 0.63
54 0.6
55 0.53
56 0.51
57 0.46
58 0.43
59 0.38
60 0.36
61 0.3
62 0.23
63 0.22
64 0.19
65 0.19
66 0.22
67 0.24
68 0.25
69 0.26
70 0.27
71 0.25
72 0.25
73 0.24
74 0.19
75 0.14
76 0.11
77 0.07
78 0.04
79 0.04
80 0.04
81 0.02
82 0.02
83 0.02
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.1
92 0.12
93 0.13
94 0.13
95 0.14
96 0.14
97 0.15
98 0.15
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.08
109 0.11
110 0.12
111 0.15
112 0.16
113 0.17
114 0.16
115 0.2
116 0.26
117 0.26
118 0.28
119 0.27
120 0.27
121 0.3
122 0.3
123 0.29
124 0.22
125 0.21
126 0.18
127 0.21
128 0.21
129 0.2
130 0.2
131 0.2
132 0.21
133 0.22
134 0.24
135 0.29
136 0.38
137 0.4
138 0.44
139 0.43
140 0.41
141 0.41
142 0.39
143 0.31
144 0.29
145 0.28
146 0.29
147 0.29
148 0.28
149 0.29
150 0.28
151 0.27
152 0.19
153 0.17
154 0.13
155 0.16
156 0.19
157 0.19
158 0.2
159 0.19
160 0.21
161 0.23
162 0.24
163 0.22
164 0.21
165 0.21
166 0.22
167 0.23
168 0.23
169 0.27
170 0.31
171 0.33
172 0.4
173 0.44
174 0.47
175 0.54
176 0.58