Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0TEJ5

Protein Details
Accession A0A0L0TEJ5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-48RAPSLTRKKWTWKRATRRAKVRERMKTMTHydrophilic
NLS Segment(s)
PositionSequence
26-44RKKWTWKRATRRAKVRERM
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MSRLLSPRQSRPPSQTPQQRAPSLTRKKWTWKRATRRAKVRERMKTMTTPTRPSATRKAVHAADLNYYLEAEPSERQYRAEDMGKGDPRRRGGQETGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.7
4 0.73
5 0.75
6 0.7
7 0.64
8 0.63
9 0.64
10 0.64
11 0.63
12 0.61
13 0.58
14 0.66
15 0.72
16 0.75
17 0.76
18 0.76
19 0.8
20 0.84
21 0.9
22 0.88
23 0.89
24 0.89
25 0.88
26 0.87
27 0.86
28 0.84
29 0.8
30 0.75
31 0.68
32 0.62
33 0.57
34 0.56
35 0.5
36 0.44
37 0.39
38 0.38
39 0.37
40 0.37
41 0.4
42 0.38
43 0.37
44 0.35
45 0.39
46 0.35
47 0.37
48 0.35
49 0.28
50 0.23
51 0.23
52 0.21
53 0.16
54 0.15
55 0.12
56 0.09
57 0.09
58 0.08
59 0.08
60 0.13
61 0.17
62 0.17
63 0.18
64 0.2
65 0.23
66 0.26
67 0.29
68 0.26
69 0.27
70 0.35
71 0.41
72 0.44
73 0.47
74 0.48
75 0.49
76 0.54
77 0.54
78 0.52