Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S7V1

Protein Details
Accession A0A0L0S7V1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-60GASAKGKKKATPKKKTPTVSKPVPHydrophilic
NLS Segment(s)
PositionSequence
28-52ASAKGASAKGASAKGKKKATPKKKT
Subcellular Location(s) cyto 15.5, cyto_nucl 9.5, mito 6, extr 3
Family & Domain DBs
Amino Acid Sequences MESIAELRWYRNHVFGVSDAVGASAKGASAKGASAKGASAKGKKKATPKKKTPTVSKPVPADASAVAAGSAPAPAPPAPASEPSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.26
4 0.22
5 0.2
6 0.15
7 0.14
8 0.13
9 0.11
10 0.1
11 0.05
12 0.04
13 0.04
14 0.05
15 0.05
16 0.05
17 0.06
18 0.07
19 0.08
20 0.08
21 0.08
22 0.09
23 0.1
24 0.13
25 0.16
26 0.2
27 0.25
28 0.32
29 0.35
30 0.39
31 0.47
32 0.55
33 0.62
34 0.67
35 0.72
36 0.75
37 0.8
38 0.84
39 0.83
40 0.83
41 0.8
42 0.77
43 0.73
44 0.65
45 0.59
46 0.53
47 0.43
48 0.35
49 0.26
50 0.21
51 0.15
52 0.13
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.04
59 0.04
60 0.06
61 0.06
62 0.09
63 0.1
64 0.13
65 0.16
66 0.19