Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0RZ42

Protein Details
Accession A0A0L0RZ42   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
16-42AAPAPSPGKRRPGRPRKHPHPDAPVGPBasic
54-73PSTPVKRGPGRPRKHPLPASBasic
NLS Segment(s)
PositionSequence
20-34PSPGKRRPGRPRKHP
59-145KRGPGRPRKHPLPASSPLAPSPKPSIPIKRGPGRPRKNAGDMDVASSPIRRGPGRPRKNAALGTDIASSPIRRGPGRPRKAAAASPK
221-250RPTPASKRARSPPPPPPVGVRRSARVPVRR
Subcellular Location(s) extr 15, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MLGSGVAALLAVSPAAAPAPSPGKRRPGRPRKHPHPDAPVGPSSSAVVVADVLPSTPVKRGPGRPRKHPLPASSPLAPSPKPSIPIKRGPGRPRKNAGDMDVASSPIRRGPGRPRKNAALGTDIASSPIRRGPGRPRKAAAASPKPAAAHLASDMDVPFSSPIKRGPGRPRKQVAAPIIESVSWGAAAANAPGPVLNAMATDNKDEALPQTPKPVQQEVRRPTPASKRARSPPPPPPVGVRRSARVPVRRKLFDQDAGSDASSSVEEGDESDDDGDAWGPASKRARVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.08
6 0.16
7 0.21
8 0.27
9 0.33
10 0.43
11 0.49
12 0.59
13 0.67
14 0.7
15 0.76
16 0.82
17 0.88
18 0.88
19 0.94
20 0.93
21 0.9
22 0.89
23 0.86
24 0.8
25 0.74
26 0.67
27 0.57
28 0.48
29 0.39
30 0.3
31 0.23
32 0.18
33 0.12
34 0.09
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.1
44 0.12
45 0.16
46 0.23
47 0.33
48 0.43
49 0.53
50 0.59
51 0.67
52 0.75
53 0.77
54 0.81
55 0.78
56 0.73
57 0.7
58 0.69
59 0.65
60 0.58
61 0.51
62 0.45
63 0.43
64 0.37
65 0.32
66 0.31
67 0.28
68 0.29
69 0.33
70 0.38
71 0.4
72 0.48
73 0.53
74 0.56
75 0.62
76 0.68
77 0.74
78 0.74
79 0.76
80 0.76
81 0.73
82 0.71
83 0.65
84 0.59
85 0.54
86 0.46
87 0.4
88 0.32
89 0.28
90 0.22
91 0.2
92 0.16
93 0.11
94 0.13
95 0.11
96 0.15
97 0.25
98 0.36
99 0.45
100 0.52
101 0.55
102 0.57
103 0.62
104 0.61
105 0.52
106 0.44
107 0.36
108 0.3
109 0.26
110 0.22
111 0.18
112 0.15
113 0.13
114 0.1
115 0.11
116 0.11
117 0.11
118 0.15
119 0.25
120 0.35
121 0.42
122 0.45
123 0.45
124 0.47
125 0.49
126 0.49
127 0.47
128 0.44
129 0.4
130 0.37
131 0.36
132 0.32
133 0.3
134 0.27
135 0.18
136 0.1
137 0.09
138 0.09
139 0.08
140 0.08
141 0.08
142 0.07
143 0.07
144 0.06
145 0.06
146 0.06
147 0.07
148 0.08
149 0.1
150 0.16
151 0.18
152 0.25
153 0.35
154 0.45
155 0.52
156 0.6
157 0.63
158 0.6
159 0.61
160 0.61
161 0.54
162 0.48
163 0.42
164 0.34
165 0.3
166 0.26
167 0.23
168 0.16
169 0.12
170 0.06
171 0.05
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.05
182 0.05
183 0.05
184 0.04
185 0.05
186 0.08
187 0.09
188 0.1
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.16
195 0.18
196 0.17
197 0.25
198 0.26
199 0.3
200 0.34
201 0.4
202 0.4
203 0.45
204 0.55
205 0.54
206 0.61
207 0.61
208 0.59
209 0.58
210 0.62
211 0.63
212 0.62
213 0.62
214 0.62
215 0.67
216 0.75
217 0.76
218 0.74
219 0.74
220 0.73
221 0.71
222 0.64
223 0.64
224 0.61
225 0.58
226 0.58
227 0.53
228 0.48
229 0.49
230 0.54
231 0.55
232 0.56
233 0.6
234 0.6
235 0.66
236 0.66
237 0.65
238 0.66
239 0.64
240 0.62
241 0.58
242 0.52
243 0.44
244 0.42
245 0.39
246 0.31
247 0.24
248 0.17
249 0.13
250 0.11
251 0.09
252 0.07
253 0.06
254 0.07
255 0.09
256 0.09
257 0.1
258 0.1
259 0.09
260 0.09
261 0.1
262 0.09
263 0.07
264 0.07
265 0.1
266 0.1
267 0.16
268 0.22