Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T5H2

Protein Details
Accession A0A0L0T5H2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-93AQRWTDTKTKKEKKSDKKLLLPAKHydrophilic
NLS Segment(s)
PositionSequence
82-83KK
Subcellular Location(s) mito 14, cyto_nucl 5, nucl 4.5, cyto 4.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR041803  DEF1_CUE  
IPR009060  UBA-like_sf  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
CDD cd14368  CUE_DEF1_like  
Amino Acid Sequences MSSSFRKSKGGKASHHQQSPVGELHAKYRDGVKSLAAVFPGWSNDDLAFVLDEASGDLELATTRILEGHAQRWTDTKTKKEKKSDKKLLLPAKELAQSHFHTTSTTSTGATDGAAAHLPRHRDRTGPRGGTGGPRSYQSGNASTGGARSTPRGRNDRQSGAISFFFSLDSVLPMIGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.66
4 0.59
5 0.54
6 0.51
7 0.43
8 0.35
9 0.29
10 0.25
11 0.3
12 0.31
13 0.28
14 0.25
15 0.29
16 0.28
17 0.28
18 0.28
19 0.23
20 0.22
21 0.23
22 0.23
23 0.18
24 0.16
25 0.14
26 0.14
27 0.14
28 0.12
29 0.11
30 0.11
31 0.1
32 0.11
33 0.1
34 0.1
35 0.09
36 0.07
37 0.07
38 0.05
39 0.05
40 0.04
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.04
48 0.04
49 0.03
50 0.03
51 0.04
52 0.04
53 0.06
54 0.08
55 0.12
56 0.15
57 0.15
58 0.16
59 0.18
60 0.21
61 0.26
62 0.28
63 0.32
64 0.4
65 0.49
66 0.57
67 0.65
68 0.72
69 0.76
70 0.84
71 0.86
72 0.82
73 0.8
74 0.81
75 0.78
76 0.7
77 0.62
78 0.52
79 0.43
80 0.39
81 0.32
82 0.25
83 0.22
84 0.21
85 0.22
86 0.21
87 0.19
88 0.16
89 0.17
90 0.17
91 0.15
92 0.15
93 0.11
94 0.11
95 0.11
96 0.11
97 0.09
98 0.08
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.1
105 0.14
106 0.16
107 0.22
108 0.22
109 0.26
110 0.31
111 0.38
112 0.45
113 0.44
114 0.42
115 0.39
116 0.39
117 0.41
118 0.4
119 0.35
120 0.27
121 0.26
122 0.28
123 0.27
124 0.29
125 0.25
126 0.24
127 0.23
128 0.23
129 0.22
130 0.19
131 0.19
132 0.16
133 0.13
134 0.11
135 0.14
136 0.21
137 0.27
138 0.35
139 0.42
140 0.47
141 0.56
142 0.63
143 0.64
144 0.62
145 0.6
146 0.54
147 0.51
148 0.46
149 0.38
150 0.3
151 0.24
152 0.19
153 0.15
154 0.14
155 0.1
156 0.1
157 0.09
158 0.08