Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SXU5

Protein Details
Accession A0A0L0SXU5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MADYWRSKPKYWCKYCKIFVTDHydrophilic
NLS Segment(s)
PositionSequence
108-120LRARRTGTIGKKK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR040023  WBP4  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF06220  zf-U1  
Amino Acid Sequences MADYWRSKPKYWCKYCKIFVTDNKISRAHHESTGEHRRSMERFIAALAEADKEKKREEAAVREMVEIIEQQLTYCLLDRTPSPLSHKTSSGKAPTPPRLKPCLPPHPLRARRTGTIGKKKAARICGTDTRPVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.83
4 0.78
5 0.75
6 0.73
7 0.72
8 0.72
9 0.66
10 0.64
11 0.57
12 0.52
13 0.49
14 0.47
15 0.4
16 0.35
17 0.34
18 0.32
19 0.39
20 0.48
21 0.44
22 0.39
23 0.38
24 0.37
25 0.36
26 0.37
27 0.31
28 0.22
29 0.21
30 0.2
31 0.19
32 0.16
33 0.14
34 0.11
35 0.09
36 0.08
37 0.1
38 0.12
39 0.13
40 0.13
41 0.14
42 0.15
43 0.2
44 0.23
45 0.27
46 0.3
47 0.34
48 0.33
49 0.32
50 0.31
51 0.25
52 0.21
53 0.14
54 0.1
55 0.06
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.05
63 0.05
64 0.06
65 0.06
66 0.11
67 0.13
68 0.15
69 0.2
70 0.25
71 0.31
72 0.32
73 0.36
74 0.34
75 0.35
76 0.39
77 0.38
78 0.36
79 0.37
80 0.42
81 0.48
82 0.52
83 0.54
84 0.55
85 0.57
86 0.57
87 0.6
88 0.62
89 0.63
90 0.62
91 0.62
92 0.66
93 0.7
94 0.75
95 0.7
96 0.69
97 0.64
98 0.61
99 0.63
100 0.63
101 0.62
102 0.65
103 0.66
104 0.64
105 0.64
106 0.68
107 0.68
108 0.66
109 0.61
110 0.55
111 0.58
112 0.61
113 0.59
114 0.6