FuNGI

A0A0L0SUG0

Protein Details

Accession

A0A0L0SUG0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
21-41	RTKGRILSWRASRRRIPNDET	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, plas 8, E.R. 5

Family & Domain DBs

InterPro	View protein in InterPro IPR031537 DUF5092
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF17010 DUF5092

Amino Acid Sequences

MPRTRTRSRSNLLKRCCGCARTKGRILSWRASRRRIPNDETKFYYSYYAAHHINKVLFRTQPEEGLLHRMKAKNPLNNMTIVGDVSYYRISPSQAHQGSPAGSSPASAASGKSAKSTSSARHSILFDKQPTTPRGTARRPSADDIFQYIAKSSPTDAAAPAIDLARLCPPPRPTSPATSARLGAPAGEVPGRRLRHQRSMSTSAVHLADLVAGAADATRGPASSSVAAPPATTHRIKVRSLSYRNDVAASGMAQPLSVDRWLAAHCGESVAQLVLEDNNKTTGSATATAAPGAQRRRVPRSASAKGSPTAPTPIIYEAKFFATDDDFLMKSSVRAFFKQHAVEADDAVLFEIPSSTTVMLPHDHQGLDPHPALDGFHYTVDRGEPMSVVAAVRAFLRGNHLLKLILVGYVVVGIVLLKFVVPENLVFLCSFILVFVLCFFLVFFVEIDI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.74
3	0.73
4	0.67
5	0.63
6	0.64
7	0.66
8	0.65
9	0.7
10	0.69
11	0.69
12	0.72
13	0.72
14	0.7
15	0.71
16	0.72
17	0.72
18	0.74
19	0.75
20	0.77
21	0.81
22	0.8
23	0.77
24	0.78
25	0.79
26	0.78
27	0.76
28	0.7
29	0.62
30	0.54
31	0.5
32	0.39
33	0.32
34	0.3
35	0.3
36	0.29
37	0.31
38	0.32
39	0.33
40	0.36
41	0.37
42	0.36
43	0.34
44	0.33
45	0.32
46	0.35
47	0.32
48	0.31
49	0.3
50	0.28
51	0.26
52	0.32
53	0.3
54	0.28
55	0.33
56	0.33
57	0.34
58	0.42
59	0.48
60	0.46
61	0.51
62	0.55
63	0.5
64	0.49
65	0.47
66	0.38
67	0.31
68	0.24
69	0.18
70	0.12
71	0.1
72	0.1
73	0.09
74	0.08
75	0.09
76	0.1
77	0.11
78	0.14
79	0.17
80	0.26
81	0.27
82	0.28
83	0.28
84	0.29
85	0.29
86	0.27
87	0.24
88	0.15
89	0.13
90	0.13
91	0.12
92	0.1
93	0.11
94	0.1
95	0.1
96	0.12
97	0.15
98	0.15
99	0.17
100	0.16
101	0.15
102	0.18
103	0.22
104	0.23
105	0.28
106	0.32
107	0.31
108	0.34
109	0.35
110	0.36
111	0.39
112	0.4
113	0.35
114	0.33
115	0.36
116	0.38
117	0.39
118	0.42
119	0.39
120	0.39
121	0.45
122	0.5
123	0.54
124	0.55
125	0.59
126	0.56
127	0.57
128	0.54
129	0.48
130	0.41
131	0.38
132	0.32
133	0.26
134	0.23
135	0.19
136	0.16
137	0.13
138	0.13
139	0.1
140	0.11
141	0.11
142	0.12
143	0.11
144	0.12
145	0.11
146	0.11
147	0.1
148	0.08
149	0.07
150	0.06
151	0.07
152	0.09
153	0.11
154	0.12
155	0.16
156	0.19
157	0.24
158	0.27
159	0.32
160	0.31
161	0.35
162	0.42
163	0.45
164	0.45
165	0.41
166	0.39
167	0.34
168	0.32
169	0.26
170	0.19
171	0.12
172	0.09
173	0.08
174	0.09
175	0.09
176	0.1
177	0.16
178	0.18
179	0.21
180	0.29
181	0.33
182	0.41
183	0.46
184	0.48
185	0.49
186	0.54
187	0.52
188	0.45
189	0.4
190	0.32
191	0.28
192	0.22
193	0.15
194	0.08
195	0.07
196	0.06
197	0.05
198	0.03
199	0.02
200	0.02
201	0.02
202	0.02
203	0.02
204	0.03
205	0.03
206	0.03
207	0.03
208	0.04
209	0.05
210	0.06
211	0.07
212	0.07
213	0.08
214	0.08
215	0.08
216	0.08
217	0.1
218	0.14
219	0.14
220	0.15
221	0.19
222	0.23
223	0.24
224	0.27
225	0.31
226	0.36
227	0.4
228	0.42
229	0.41
230	0.39
231	0.39
232	0.36
233	0.29
234	0.2
235	0.16
236	0.13
237	0.1
238	0.08
239	0.07
240	0.06
241	0.06
242	0.06
243	0.07
244	0.06
245	0.05
246	0.05
247	0.06
248	0.06
249	0.07
250	0.07
251	0.07
252	0.07
253	0.08
254	0.08
255	0.07
256	0.07
257	0.06
258	0.06
259	0.05
260	0.05
261	0.06
262	0.07
263	0.07
264	0.07
265	0.09
266	0.09
267	0.09
268	0.09
269	0.09
270	0.1
271	0.12
272	0.12
273	0.13
274	0.13
275	0.13
276	0.13
277	0.13
278	0.15
279	0.16
280	0.2
281	0.22
282	0.28
283	0.35
284	0.39
285	0.42
286	0.47
287	0.53
288	0.55
289	0.56
290	0.55
291	0.51
292	0.46
293	0.44
294	0.37
295	0.29
296	0.26
297	0.21
298	0.19
299	0.17
300	0.2
301	0.21
302	0.2
303	0.19
304	0.17
305	0.18
306	0.17
307	0.16
308	0.13
309	0.12
310	0.12
311	0.12
312	0.14
313	0.12
314	0.12
315	0.13
316	0.12
317	0.11
318	0.13
319	0.18
320	0.18
321	0.2
322	0.23
323	0.27
324	0.34
325	0.35
326	0.34
327	0.3
328	0.3
329	0.29
330	0.26
331	0.22
332	0.15
333	0.13
334	0.12
335	0.09
336	0.06
337	0.06
338	0.05
339	0.05
340	0.05
341	0.07
342	0.07
343	0.08
344	0.09
345	0.11
346	0.12
347	0.14
348	0.16
349	0.17
350	0.16
351	0.16
352	0.19
353	0.19
354	0.23
355	0.22
356	0.19
357	0.16
358	0.16
359	0.17
360	0.15
361	0.16
362	0.12
363	0.13
364	0.14
365	0.14
366	0.15
367	0.15
368	0.15
369	0.12
370	0.12
371	0.1
372	0.1
373	0.11
374	0.1
375	0.09
376	0.09
377	0.08
378	0.08
379	0.08
380	0.09
381	0.09
382	0.08
383	0.15
384	0.21
385	0.23
386	0.25
387	0.25
388	0.24
389	0.24
390	0.25
391	0.19
392	0.13
393	0.11
394	0.08
395	0.07
396	0.07
397	0.06
398	0.04
399	0.04
400	0.03
401	0.03
402	0.04
403	0.04
404	0.03
405	0.04
406	0.05
407	0.07
408	0.08
409	0.08
410	0.11
411	0.12
412	0.13
413	0.13
414	0.13
415	0.11
416	0.1
417	0.1
418	0.07
419	0.07
420	0.06
421	0.06
422	0.06
423	0.07
424	0.07
425	0.07
426	0.07
427	0.07
428	0.08
429	0.09

A0A0L0SUG0

3D AlphaFold-predicted Structure Viewer