Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SM77

Protein Details
Accession A0A0L0SM77    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
79-101QAEKVQAEKKRKEEKAREEEKAKBasic
NLS Segment(s)
PositionSequence
85-102AEKKRKEEKAREEEKAKA
Subcellular Location(s) mito 7.5, cyto_mito 7.333, cyto 6, cyto_nucl 5.333, E.R. 5, nucl 3.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSMAQVLKSILNVQEERLALEKEKFKDQQTSGFLETKYYISMMILGMVTVLAGLGNLAITARSAVQQEEREKVCKEKAQAEKVQAEKKRKEEKAREEEKAKAQKSWFGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.23
5 0.22
6 0.19
7 0.24
8 0.29
9 0.27
10 0.34
11 0.35
12 0.35
13 0.42
14 0.42
15 0.44
16 0.41
17 0.42
18 0.38
19 0.39
20 0.36
21 0.29
22 0.29
23 0.22
24 0.18
25 0.14
26 0.11
27 0.07
28 0.08
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.02
38 0.02
39 0.01
40 0.01
41 0.01
42 0.01
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.04
50 0.05
51 0.06
52 0.09
53 0.14
54 0.17
55 0.21
56 0.23
57 0.25
58 0.26
59 0.29
60 0.31
61 0.3
62 0.31
63 0.35
64 0.42
65 0.46
66 0.5
67 0.51
68 0.53
69 0.55
70 0.6
71 0.58
72 0.58
73 0.57
74 0.63
75 0.68
76 0.69
77 0.74
78 0.76
79 0.81
80 0.82
81 0.84
82 0.82
83 0.76
84 0.74
85 0.73
86 0.73
87 0.64
88 0.59
89 0.53