Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0TBK9

Protein Details
Accession A0A0L0TBK9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
135-160TPTVPAAPGKKTRKCRPRKPKTVAHYHydrophilic
NLS Segment(s)
PositionSequence
143-155GKKTRKCRPRKPK
Subcellular Location(s) extr 13, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MSHLVSQLVLATALLAAIASAAPSGPIKSGTARLASFGDVSPALVKRGLASGRGEGTYYDVGLGAWESTNSNSELVVALNAPEFGPAWPPRSSAACSSCLAISSPENPSAGTVVVRIVDKCPGTAASTPAPTTVTPTVPAAPGKKTRKCRPRKPKTVAHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.06
13 0.08
14 0.09
15 0.11
16 0.16
17 0.17
18 0.2
19 0.19
20 0.2
21 0.2
22 0.2
23 0.19
24 0.15
25 0.14
26 0.11
27 0.11
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.09
34 0.13
35 0.14
36 0.13
37 0.14
38 0.15
39 0.16
40 0.16
41 0.16
42 0.12
43 0.14
44 0.12
45 0.11
46 0.09
47 0.07
48 0.07
49 0.06
50 0.07
51 0.04
52 0.03
53 0.04
54 0.04
55 0.05
56 0.06
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.08
73 0.09
74 0.13
75 0.13
76 0.14
77 0.15
78 0.17
79 0.19
80 0.2
81 0.21
82 0.21
83 0.21
84 0.21
85 0.2
86 0.18
87 0.16
88 0.13
89 0.12
90 0.11
91 0.13
92 0.13
93 0.13
94 0.13
95 0.13
96 0.12
97 0.11
98 0.09
99 0.07
100 0.06
101 0.08
102 0.09
103 0.09
104 0.09
105 0.13
106 0.13
107 0.13
108 0.13
109 0.13
110 0.15
111 0.16
112 0.19
113 0.18
114 0.2
115 0.2
116 0.2
117 0.2
118 0.17
119 0.21
120 0.2
121 0.18
122 0.17
123 0.19
124 0.2
125 0.21
126 0.25
127 0.22
128 0.26
129 0.34
130 0.42
131 0.49
132 0.58
133 0.67
134 0.74
135 0.82
136 0.87
137 0.89
138 0.91
139 0.94
140 0.93