Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SGJ4

Protein Details
Accession A0A0L0SGJ4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
94-119CSYGRVSHARKCPRPRGDSPARPRRWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000608  UBQ-conjugat_E2  
IPR016135  UBQ-conjugating_enzyme/RWD  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS50127  UBC_2  
Amino Acid Sequences MKGELAGPAGTPYEGGQFVLDIKIPDTYPFAPPVIKFETSVLSYTAGIRHLSSHTPNCPRQYCRDSAVPAMPGTARAPPRQYSTSHARHCPRHCSYGRVSHARKCPRPRGDSPARPRRWVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.1
6 0.1
7 0.11
8 0.08
9 0.09
10 0.1
11 0.1
12 0.11
13 0.14
14 0.15
15 0.16
16 0.17
17 0.18
18 0.18
19 0.18
20 0.21
21 0.22
22 0.21
23 0.2
24 0.19
25 0.2
26 0.2
27 0.2
28 0.16
29 0.13
30 0.12
31 0.12
32 0.12
33 0.11
34 0.1
35 0.09
36 0.1
37 0.1
38 0.12
39 0.16
40 0.18
41 0.23
42 0.29
43 0.32
44 0.36
45 0.39
46 0.39
47 0.43
48 0.44
49 0.41
50 0.38
51 0.38
52 0.34
53 0.32
54 0.32
55 0.26
56 0.21
57 0.19
58 0.15
59 0.12
60 0.12
61 0.14
62 0.15
63 0.16
64 0.19
65 0.21
66 0.26
67 0.27
68 0.28
69 0.29
70 0.36
71 0.43
72 0.45
73 0.51
74 0.53
75 0.59
76 0.62
77 0.66
78 0.62
79 0.62
80 0.58
81 0.57
82 0.56
83 0.58
84 0.61
85 0.61
86 0.6
87 0.59
88 0.66
89 0.71
90 0.74
91 0.73
92 0.76
93 0.76
94 0.8
95 0.79
96 0.79
97 0.8
98 0.81
99 0.83
100 0.83
101 0.79