Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W757

Protein Details
Accession B2W757    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-82RGKAKGRKEKDDKKRKAQGQBasic
NLS Segment(s)
PositionSequence
63-78RGKAKGRKEKDDKKRK
Subcellular Location(s) nucl 8, mito 8, mito_nucl 8, pero 6
Family & Domain DBs
Amino Acid Sequences MDKVRGLVCTQAQTRDQDDERHGFPRGSADAKRWEQKHDNKQPSWGNIICGVVIFRTGTWLERGKAKGRKEKDDKKRKAQGQDCWMPSLHVISGGLEAKGAVPAKYIHTPRDEVTKNKFLGSLNSRKAAKRTSSAKDMRTTRAYPASRAEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.38
4 0.36
5 0.39
6 0.39
7 0.38
8 0.37
9 0.36
10 0.29
11 0.27
12 0.27
13 0.25
14 0.26
15 0.25
16 0.26
17 0.33
18 0.39
19 0.46
20 0.42
21 0.47
22 0.52
23 0.6
24 0.67
25 0.69
26 0.72
27 0.66
28 0.72
29 0.69
30 0.63
31 0.59
32 0.49
33 0.39
34 0.32
35 0.31
36 0.23
37 0.18
38 0.15
39 0.08
40 0.08
41 0.07
42 0.04
43 0.06
44 0.07
45 0.07
46 0.11
47 0.13
48 0.14
49 0.18
50 0.21
51 0.27
52 0.33
53 0.38
54 0.44
55 0.46
56 0.55
57 0.6
58 0.68
59 0.72
60 0.76
61 0.78
62 0.79
63 0.83
64 0.79
65 0.79
66 0.75
67 0.71
68 0.68
69 0.68
70 0.59
71 0.52
72 0.46
73 0.37
74 0.3
75 0.24
76 0.15
77 0.08
78 0.07
79 0.06
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.06
86 0.09
87 0.09
88 0.07
89 0.08
90 0.09
91 0.13
92 0.19
93 0.21
94 0.22
95 0.24
96 0.27
97 0.27
98 0.35
99 0.35
100 0.34
101 0.4
102 0.45
103 0.42
104 0.41
105 0.42
106 0.33
107 0.38
108 0.41
109 0.42
110 0.39
111 0.45
112 0.47
113 0.47
114 0.51
115 0.49
116 0.47
117 0.46
118 0.49
119 0.5
120 0.58
121 0.61
122 0.62
123 0.64
124 0.63
125 0.62
126 0.6
127 0.55
128 0.52
129 0.55
130 0.52
131 0.47