Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0T1P3

Protein Details
Accession A0A0L0T1P3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-89VTAKGKKKSAPKMKKTTISKPHydrophilic
NLS Segment(s)
PositionSequence
72-83KGKKKSAPKMKK
Subcellular Location(s) mito 17, nucl 6, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MPRVTGYLNHRLLDVSSIAQVASWWFPAKASLRPPKTDTHRADRDIMESIAELRWYRTHVFGVSDSLGVTAKGKKKSAPKMKKTTISKPALNASASAAATGSAPAPAPPAPAPEPSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.14
3 0.12
4 0.11
5 0.11
6 0.1
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.1
14 0.14
15 0.17
16 0.2
17 0.28
18 0.37
19 0.4
20 0.44
21 0.46
22 0.5
23 0.55
24 0.6
25 0.57
26 0.56
27 0.58
28 0.57
29 0.58
30 0.5
31 0.44
32 0.36
33 0.31
34 0.21
35 0.15
36 0.13
37 0.1
38 0.1
39 0.08
40 0.07
41 0.08
42 0.09
43 0.11
44 0.11
45 0.11
46 0.11
47 0.13
48 0.12
49 0.13
50 0.12
51 0.11
52 0.09
53 0.09
54 0.08
55 0.07
56 0.08
57 0.11
58 0.16
59 0.2
60 0.21
61 0.25
62 0.34
63 0.45
64 0.55
65 0.61
66 0.65
67 0.72
68 0.78
69 0.83
70 0.81
71 0.8
72 0.79
73 0.74
74 0.67
75 0.6
76 0.58
77 0.51
78 0.45
79 0.36
80 0.28
81 0.25
82 0.22
83 0.19
84 0.14
85 0.11
86 0.11
87 0.11
88 0.09
89 0.05
90 0.06
91 0.06
92 0.08
93 0.09
94 0.12
95 0.12
96 0.18
97 0.2
98 0.24