Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0TDX9

Protein Details
Accession A0A0L0TDX9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
327-356PTSTPPPPCTTRRRWPPRSTRSSGRARPTAHydrophilic
NLS Segment(s)
PositionSequence
289-289P
340-354RWPPRSTRSSGRARP
Subcellular Location(s) extr 11, mito 10, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MSPCTTAPTRTTTRLNSSTCPCAAMLPTTWSRHDTTMLSPSPCLRSRSPCAHDRSCATSSPTRGTAPPRRFVVTCGGGRRGSLQRRCWCWFSFPLVVRVLVSLISDAQPSTSPHLPHRPGAAAGRLTHLLAVRPAHALPAAPSTVVPVRPHPHGDILGTHCAPSCRPARCASPLPARARASAAPSSLSCGIGGWRWKIIRRRNASVCLLGPAACVRGRSSSPPPFSLLELLVVQRPGSSSSRKVLLSRKVPYPTRSQSSRRIPPPPPRSTPPPPLPAHCPRSPNPARGPRSAPSAFPPPRPPPATRRCPSSPRHSRAPCSSHTPCTPTSTPPPPCTTRRRWPPRSTRSSGRARPTAPAAPSRRTHGSPPPWTGSCAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.57
4 0.56
5 0.56
6 0.5
7 0.46
8 0.37
9 0.32
10 0.3
11 0.26
12 0.23
13 0.23
14 0.28
15 0.3
16 0.32
17 0.32
18 0.33
19 0.32
20 0.33
21 0.29
22 0.28
23 0.33
24 0.36
25 0.34
26 0.33
27 0.35
28 0.38
29 0.4
30 0.41
31 0.37
32 0.41
33 0.47
34 0.56
35 0.58
36 0.6
37 0.64
38 0.64
39 0.63
40 0.59
41 0.58
42 0.5
43 0.47
44 0.45
45 0.42
46 0.41
47 0.41
48 0.39
49 0.35
50 0.36
51 0.42
52 0.47
53 0.47
54 0.51
55 0.49
56 0.5
57 0.49
58 0.48
59 0.47
60 0.44
61 0.42
62 0.4
63 0.41
64 0.37
65 0.37
66 0.4
67 0.4
68 0.43
69 0.45
70 0.5
71 0.54
72 0.61
73 0.66
74 0.64
75 0.57
76 0.53
77 0.5
78 0.47
79 0.46
80 0.41
81 0.41
82 0.38
83 0.36
84 0.31
85 0.27
86 0.2
87 0.13
88 0.11
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.09
96 0.1
97 0.14
98 0.17
99 0.19
100 0.23
101 0.33
102 0.34
103 0.35
104 0.37
105 0.33
106 0.31
107 0.32
108 0.31
109 0.24
110 0.22
111 0.22
112 0.2
113 0.18
114 0.17
115 0.16
116 0.12
117 0.12
118 0.12
119 0.11
120 0.12
121 0.12
122 0.11
123 0.11
124 0.1
125 0.09
126 0.1
127 0.1
128 0.08
129 0.08
130 0.1
131 0.12
132 0.14
133 0.14
134 0.16
135 0.19
136 0.21
137 0.24
138 0.23
139 0.23
140 0.21
141 0.21
142 0.2
143 0.2
144 0.22
145 0.19
146 0.18
147 0.17
148 0.16
149 0.16
150 0.17
151 0.2
152 0.19
153 0.21
154 0.24
155 0.27
156 0.32
157 0.36
158 0.37
159 0.4
160 0.44
161 0.46
162 0.49
163 0.47
164 0.42
165 0.4
166 0.35
167 0.3
168 0.24
169 0.21
170 0.16
171 0.14
172 0.16
173 0.14
174 0.14
175 0.09
176 0.08
177 0.08
178 0.09
179 0.11
180 0.1
181 0.12
182 0.13
183 0.18
184 0.26
185 0.34
186 0.41
187 0.45
188 0.52
189 0.54
190 0.58
191 0.56
192 0.5
193 0.42
194 0.34
195 0.28
196 0.21
197 0.16
198 0.11
199 0.11
200 0.09
201 0.09
202 0.08
203 0.11
204 0.12
205 0.16
206 0.24
207 0.29
208 0.31
209 0.32
210 0.34
211 0.32
212 0.32
213 0.29
214 0.22
215 0.15
216 0.13
217 0.13
218 0.11
219 0.1
220 0.09
221 0.08
222 0.08
223 0.1
224 0.12
225 0.15
226 0.17
227 0.19
228 0.23
229 0.24
230 0.27
231 0.32
232 0.37
233 0.41
234 0.43
235 0.46
236 0.49
237 0.52
238 0.52
239 0.53
240 0.52
241 0.51
242 0.53
243 0.52
244 0.56
245 0.61
246 0.67
247 0.64
248 0.66
249 0.66
250 0.71
251 0.75
252 0.73
253 0.7
254 0.67
255 0.69
256 0.69
257 0.71
258 0.68
259 0.66
260 0.61
261 0.59
262 0.61
263 0.61
264 0.61
265 0.55
266 0.54
267 0.48
268 0.56
269 0.58
270 0.57
271 0.57
272 0.6
273 0.61
274 0.61
275 0.63
276 0.55
277 0.58
278 0.52
279 0.44
280 0.39
281 0.44
282 0.42
283 0.42
284 0.48
285 0.45
286 0.52
287 0.55
288 0.55
289 0.55
290 0.62
291 0.67
292 0.63
293 0.66
294 0.64
295 0.68
296 0.7
297 0.71
298 0.72
299 0.68
300 0.75
301 0.73
302 0.73
303 0.74
304 0.73
305 0.66
306 0.64
307 0.62
308 0.59
309 0.57
310 0.54
311 0.47
312 0.49
313 0.47
314 0.44
315 0.47
316 0.5
317 0.53
318 0.53
319 0.58
320 0.56
321 0.62
322 0.65
323 0.66
324 0.67
325 0.72
326 0.78
327 0.81
328 0.86
329 0.89
330 0.91
331 0.92
332 0.88
333 0.87
334 0.85
335 0.86
336 0.83
337 0.81
338 0.77
339 0.69
340 0.67
341 0.63
342 0.61
343 0.54
344 0.55
345 0.52
346 0.52
347 0.53
348 0.55
349 0.55
350 0.51
351 0.54
352 0.55
353 0.59
354 0.6
355 0.64
356 0.65
357 0.6