Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SLQ6

Protein Details
Accession A0A0L0SLQ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-88VRKGRRYVLCKKSTRHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 5, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MIAALAAARTSVAAAAVVRASMRTLLATPTVAVTRPVTPAAAAMASSVRGYQVRASVKPRCEHCYVVVRKGRRYVLCKKSTRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.07
10 0.06
11 0.07
12 0.08
13 0.09
14 0.09
15 0.08
16 0.09
17 0.09
18 0.09
19 0.1
20 0.1
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.09
27 0.09
28 0.07
29 0.06
30 0.05
31 0.04
32 0.05
33 0.05
34 0.04
35 0.05
36 0.05
37 0.06
38 0.07
39 0.12
40 0.15
41 0.18
42 0.24
43 0.29
44 0.34
45 0.39
46 0.42
47 0.42
48 0.42
49 0.41
50 0.41
51 0.45
52 0.44
53 0.48
54 0.5
55 0.49
56 0.5
57 0.55
58 0.57
59 0.54
60 0.57
61 0.59
62 0.63
63 0.68
64 0.71
65 0.72
66 0.76
67 0.8
68 0.84