Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0RVB2

Protein Details
Accession A0A0L0RVB2    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-40AKKPAPSKKRATSKPAAARSHydrophilic
124-172FAEQRQAKREQKQQEKKNLLNKVKNKLKQKTKSKPKRLQQSQAPRPASNHydrophilic
NLS Segment(s)
PositionSequence
3-36KPKPSAPGLRKGNKAGAAAKKPAPSKKRATSKPA
84-84K
131-162KREQKQQEKKNLLNKVKNKLKQKTKSKPKRLQ
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGKPKPSAPGLRKGNKAGAAAKKPAPSKKRATSKPAAARSSTAPDSNDKNDANAMEQDQDDAPAADAPVPAHLQPRKPRTASHKKGGKMIASTDAMMALISEICDEQESQESAKLEKAQEKLDFAEQRQAKREQKQQEKKNLLNKVKNKLKQKTKSKPKRLQQSQAPRPASNGKKVSFAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.58
4 0.55
5 0.54
6 0.52
7 0.52
8 0.52
9 0.51
10 0.53
11 0.59
12 0.58
13 0.56
14 0.6
15 0.65
16 0.71
17 0.72
18 0.75
19 0.74
20 0.78
21 0.8
22 0.79
23 0.72
24 0.63
25 0.57
26 0.52
27 0.49
28 0.41
29 0.33
30 0.27
31 0.27
32 0.31
33 0.31
34 0.33
35 0.27
36 0.25
37 0.25
38 0.24
39 0.22
40 0.19
41 0.17
42 0.13
43 0.13
44 0.14
45 0.12
46 0.12
47 0.1
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.08
58 0.13
59 0.15
60 0.21
61 0.28
62 0.35
63 0.39
64 0.39
65 0.43
66 0.48
67 0.57
68 0.58
69 0.6
70 0.6
71 0.56
72 0.6
73 0.58
74 0.49
75 0.39
76 0.33
77 0.27
78 0.21
79 0.2
80 0.14
81 0.12
82 0.09
83 0.08
84 0.07
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.07
95 0.08
96 0.08
97 0.11
98 0.11
99 0.11
100 0.14
101 0.15
102 0.15
103 0.19
104 0.21
105 0.23
106 0.23
107 0.24
108 0.24
109 0.28
110 0.29
111 0.25
112 0.32
113 0.31
114 0.32
115 0.36
116 0.42
117 0.42
118 0.48
119 0.55
120 0.57
121 0.65
122 0.73
123 0.77
124 0.8
125 0.82
126 0.81
127 0.81
128 0.81
129 0.79
130 0.78
131 0.76
132 0.76
133 0.77
134 0.78
135 0.8
136 0.8
137 0.81
138 0.82
139 0.86
140 0.86
141 0.88
142 0.92
143 0.93
144 0.93
145 0.92
146 0.94
147 0.92
148 0.91
149 0.9
150 0.91
151 0.89
152 0.89
153 0.84
154 0.73
155 0.68
156 0.68
157 0.64
158 0.62
159 0.59
160 0.51