Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WQ16

Protein Details
Accession B2WQ16    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-72VSRTFPKVMRTKKYRQKCDEVARAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7.5cyto_nucl 7.5, cyto 6.5, pero 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR017972  Cyt_P450_CS  
IPR002401  Cyt_P450_E_grp-I  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00067  p450  
PROSITE View protein in PROSITE  
PS00086  CYTOCHROME_P450  
Amino Acid Sequences MKIQELHKQYDLFPEWHKTIKDVMEIGMITRHIPWAIVPLFFLPEWFVSRTFPKVMRTKKYRQKCDEVARAVFQGSKAKDDTLEGEPSTHPPLFNGLANARLPPEERTEERVNHEIVSLIGAGTETTANTLAVITFHVLDKPQILNRLRNELGNTGVIFEGLRLSYGLSHRSQRSSPEGPLYYKDIKIPPNTPVGMTSVMIHHDESIFPRSHDFIPERWTDLQERKILNKYLVAFGRGSRQCVGMKNIWIKAGLSARSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.42
4 0.41
5 0.34
6 0.35
7 0.35
8 0.34
9 0.29
10 0.27
11 0.24
12 0.24
13 0.22
14 0.19
15 0.16
16 0.13
17 0.13
18 0.13
19 0.1
20 0.1
21 0.1
22 0.15
23 0.16
24 0.15
25 0.15
26 0.15
27 0.17
28 0.16
29 0.17
30 0.11
31 0.11
32 0.14
33 0.15
34 0.15
35 0.16
36 0.19
37 0.22
38 0.24
39 0.26
40 0.31
41 0.38
42 0.46
43 0.53
44 0.59
45 0.66
46 0.72
47 0.8
48 0.83
49 0.81
50 0.82
51 0.81
52 0.83
53 0.81
54 0.76
55 0.68
56 0.59
57 0.52
58 0.44
59 0.35
60 0.27
61 0.25
62 0.2
63 0.2
64 0.19
65 0.19
66 0.19
67 0.19
68 0.21
69 0.18
70 0.19
71 0.16
72 0.17
73 0.17
74 0.19
75 0.22
76 0.18
77 0.15
78 0.13
79 0.16
80 0.16
81 0.16
82 0.16
83 0.13
84 0.15
85 0.16
86 0.16
87 0.13
88 0.12
89 0.13
90 0.12
91 0.16
92 0.17
93 0.18
94 0.24
95 0.28
96 0.29
97 0.32
98 0.33
99 0.3
100 0.26
101 0.24
102 0.18
103 0.14
104 0.12
105 0.08
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.07
128 0.08
129 0.1
130 0.16
131 0.19
132 0.24
133 0.25
134 0.32
135 0.31
136 0.3
137 0.3
138 0.24
139 0.24
140 0.19
141 0.18
142 0.12
143 0.11
144 0.1
145 0.08
146 0.07
147 0.06
148 0.05
149 0.05
150 0.04
151 0.04
152 0.07
153 0.08
154 0.11
155 0.13
156 0.18
157 0.2
158 0.23
159 0.24
160 0.26
161 0.32
162 0.33
163 0.33
164 0.34
165 0.35
166 0.33
167 0.34
168 0.36
169 0.32
170 0.29
171 0.31
172 0.29
173 0.31
174 0.34
175 0.34
176 0.31
177 0.34
178 0.33
179 0.3
180 0.27
181 0.24
182 0.21
183 0.19
184 0.17
185 0.12
186 0.13
187 0.14
188 0.13
189 0.11
190 0.1
191 0.11
192 0.13
193 0.16
194 0.15
195 0.15
196 0.17
197 0.19
198 0.2
199 0.25
200 0.25
201 0.24
202 0.28
203 0.3
204 0.32
205 0.31
206 0.33
207 0.33
208 0.37
209 0.4
210 0.41
211 0.42
212 0.43
213 0.48
214 0.49
215 0.45
216 0.43
217 0.39
218 0.4
219 0.39
220 0.36
221 0.3
222 0.28
223 0.36
224 0.33
225 0.34
226 0.28
227 0.3
228 0.31
229 0.35
230 0.4
231 0.36
232 0.42
233 0.45
234 0.46
235 0.44
236 0.41
237 0.37
238 0.37
239 0.37
240 0.31