Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T5Z7

Protein Details
Accession A0A0L0T5Z7    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPSDRSEKSKKRKERADEPVDTPHydrophilic
37-66IDDAAVPKKEKKRSKKEKKDKSAPPPAPKPBasic
NLS Segment(s)
PositionSequence
9-15KSKKRKE
42-67VPKKEKKRSKKEKKDKSAPPPAPKPA
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026714  SMAP  
IPR028124  SMAP_dom  
Pfam View protein in Pfam  
PF15477  SMAP  
Amino Acid Sequences MAPSDRSEKSKKRKERADEPVDTPATDSPVKKAKTSIDDAAVPKKEKKRSKKEKKDKSAPPPAPKPAPTDPAPAPAAAPAGRWNDWTQADLGDSGRQSKFLRLLGAKKAGADAPAPSVAAPTASATGPTVINAQYGQRITADLEKQLEAGRSTQRGKQQGRSRGIGFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.87
5 0.83
6 0.76
7 0.74
8 0.64
9 0.55
10 0.46
11 0.36
12 0.3
13 0.27
14 0.24
15 0.21
16 0.28
17 0.3
18 0.29
19 0.32
20 0.34
21 0.36
22 0.41
23 0.4
24 0.35
25 0.38
26 0.39
27 0.42
28 0.41
29 0.37
30 0.38
31 0.43
32 0.49
33 0.54
34 0.63
35 0.67
36 0.74
37 0.84
38 0.88
39 0.92
40 0.94
41 0.95
42 0.95
43 0.93
44 0.91
45 0.91
46 0.87
47 0.84
48 0.79
49 0.74
50 0.68
51 0.6
52 0.57
53 0.49
54 0.47
55 0.4
56 0.38
57 0.33
58 0.33
59 0.32
60 0.25
61 0.21
62 0.17
63 0.16
64 0.11
65 0.11
66 0.1
67 0.12
68 0.12
69 0.13
70 0.14
71 0.16
72 0.16
73 0.17
74 0.13
75 0.11
76 0.11
77 0.1
78 0.1
79 0.08
80 0.08
81 0.1
82 0.1
83 0.12
84 0.12
85 0.14
86 0.17
87 0.16
88 0.2
89 0.2
90 0.24
91 0.27
92 0.31
93 0.29
94 0.26
95 0.25
96 0.22
97 0.2
98 0.17
99 0.12
100 0.1
101 0.1
102 0.1
103 0.09
104 0.09
105 0.08
106 0.07
107 0.07
108 0.06
109 0.07
110 0.07
111 0.07
112 0.07
113 0.09
114 0.08
115 0.09
116 0.1
117 0.08
118 0.09
119 0.1
120 0.1
121 0.13
122 0.13
123 0.13
124 0.12
125 0.13
126 0.14
127 0.2
128 0.2
129 0.19
130 0.21
131 0.21
132 0.21
133 0.22
134 0.22
135 0.18
136 0.2
137 0.22
138 0.26
139 0.29
140 0.34
141 0.4
142 0.47
143 0.52
144 0.58
145 0.62
146 0.66
147 0.7
148 0.7