Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0RYU5

Protein Details
Accession A0A0L0RYU5    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
554-596LGTRAGRRRLRASPARRRGRTQLLQESPCEQAQRRRRPCKKFTHydrophilic
NLS Segment(s)
PositionSequence
246-286KRCKGGPGKKRKGISAEEKEARKQERVMRNRIAAQESRNKK
557-573RAGRRRLRASPARRRGR
Subcellular Location(s) nucl 18, cyto 5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006986  P:response to unfolded protein  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14691  bZIP_XBP1  
Amino Acid Sequences MPDSPPLSPISPLLLDSIRSRPAANDAMAATASPDPQSAAAGSSRWPMNLAATPMPMLAGFPGIAPLPSVPPMGTAWPGIAAPAATMPFVPTTSAAPVAAGAVPGFTVYWVPSAAVPNLVYPTGDTATPLPDLTSSLGTVASASWGLAQSMSPQVDTAPSSPWIMLSPTASPVHAEPSQPPTEPRSTARSTSTPLTPITATPTSESGSQSPSPDPDATPAPESSASRPKRKPLNIVVPPVPPLMEKRCKGGPGKKRKGISAEEKEARKQERVMRNRIAAQESRNKKRAWVEALETTTAELQDENATLVETNERLHKRVKLLEDENKALNSRLDAIMAEISAMRSGESSMPVVSSSQSSPASMAATSSPTTLDWMSPPLTGAFGASSYQIDPALDLSPWLVPDAAFDAAPMAVDAPAAAAAAPTSSDLADPTLTSSTLVSVTLDELTRLLFHDRAPGPAVSEALAYANRSLQWKRSIWNVEPWVKASLVLETWMACVRTVHWAMVAWVAARAVAASSSLAMPSSRAEMSVLRARAAMACGATADGPFGCKLVLGLGTRAGRRRLRASPARRRGRTQLLQESPCEQAQRRRRPCKKFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.26
5 0.25
6 0.25
7 0.26
8 0.24
9 0.29
10 0.31
11 0.29
12 0.27
13 0.23
14 0.24
15 0.23
16 0.21
17 0.17
18 0.14
19 0.14
20 0.11
21 0.11
22 0.1
23 0.11
24 0.12
25 0.1
26 0.11
27 0.11
28 0.12
29 0.13
30 0.18
31 0.18
32 0.17
33 0.18
34 0.17
35 0.2
36 0.23
37 0.26
38 0.22
39 0.22
40 0.22
41 0.21
42 0.2
43 0.16
44 0.12
45 0.08
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.11
56 0.12
57 0.1
58 0.12
59 0.13
60 0.15
61 0.15
62 0.13
63 0.12
64 0.12
65 0.12
66 0.1
67 0.1
68 0.07
69 0.06
70 0.07
71 0.08
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.13
82 0.12
83 0.11
84 0.11
85 0.11
86 0.1
87 0.08
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.09
100 0.12
101 0.12
102 0.14
103 0.13
104 0.13
105 0.15
106 0.14
107 0.12
108 0.1
109 0.13
110 0.11
111 0.11
112 0.11
113 0.1
114 0.12
115 0.13
116 0.13
117 0.1
118 0.09
119 0.11
120 0.11
121 0.11
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.12
138 0.12
139 0.11
140 0.11
141 0.11
142 0.13
143 0.14
144 0.13
145 0.11
146 0.12
147 0.13
148 0.13
149 0.13
150 0.12
151 0.12
152 0.12
153 0.11
154 0.11
155 0.13
156 0.14
157 0.14
158 0.14
159 0.13
160 0.17
161 0.17
162 0.17
163 0.16
164 0.22
165 0.24
166 0.24
167 0.25
168 0.26
169 0.28
170 0.29
171 0.3
172 0.3
173 0.31
174 0.33
175 0.36
176 0.33
177 0.33
178 0.33
179 0.32
180 0.27
181 0.24
182 0.24
183 0.2
184 0.18
185 0.2
186 0.19
187 0.17
188 0.16
189 0.17
190 0.16
191 0.18
192 0.19
193 0.14
194 0.16
195 0.17
196 0.18
197 0.17
198 0.18
199 0.19
200 0.18
201 0.18
202 0.16
203 0.18
204 0.17
205 0.18
206 0.17
207 0.16
208 0.17
209 0.17
210 0.19
211 0.26
212 0.3
213 0.36
214 0.39
215 0.45
216 0.53
217 0.56
218 0.6
219 0.59
220 0.65
221 0.62
222 0.65
223 0.6
224 0.52
225 0.49
226 0.41
227 0.32
228 0.22
229 0.19
230 0.22
231 0.26
232 0.26
233 0.28
234 0.3
235 0.34
236 0.4
237 0.45
238 0.48
239 0.52
240 0.61
241 0.63
242 0.62
243 0.61
244 0.6
245 0.58
246 0.58
247 0.54
248 0.53
249 0.52
250 0.52
251 0.51
252 0.51
253 0.47
254 0.38
255 0.35
256 0.36
257 0.4
258 0.46
259 0.5
260 0.5
261 0.5
262 0.52
263 0.5
264 0.45
265 0.37
266 0.34
267 0.36
268 0.4
269 0.44
270 0.46
271 0.43
272 0.43
273 0.46
274 0.47
275 0.43
276 0.38
277 0.35
278 0.34
279 0.35
280 0.32
281 0.26
282 0.21
283 0.16
284 0.13
285 0.1
286 0.05
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.12
299 0.13
300 0.14
301 0.17
302 0.2
303 0.23
304 0.28
305 0.3
306 0.3
307 0.35
308 0.41
309 0.42
310 0.41
311 0.39
312 0.35
313 0.32
314 0.26
315 0.2
316 0.13
317 0.11
318 0.09
319 0.09
320 0.08
321 0.08
322 0.08
323 0.07
324 0.07
325 0.05
326 0.05
327 0.05
328 0.05
329 0.04
330 0.04
331 0.05
332 0.06
333 0.06
334 0.07
335 0.07
336 0.07
337 0.07
338 0.07
339 0.07
340 0.08
341 0.07
342 0.1
343 0.1
344 0.1
345 0.1
346 0.11
347 0.11
348 0.09
349 0.09
350 0.07
351 0.08
352 0.08
353 0.08
354 0.08
355 0.07
356 0.09
357 0.09
358 0.09
359 0.08
360 0.1
361 0.11
362 0.1
363 0.11
364 0.09
365 0.09
366 0.09
367 0.08
368 0.06
369 0.05
370 0.06
371 0.06
372 0.06
373 0.06
374 0.07
375 0.07
376 0.06
377 0.06
378 0.07
379 0.07
380 0.07
381 0.06
382 0.06
383 0.07
384 0.07
385 0.07
386 0.06
387 0.05
388 0.06
389 0.08
390 0.08
391 0.07
392 0.07
393 0.07
394 0.07
395 0.07
396 0.06
397 0.04
398 0.04
399 0.04
400 0.04
401 0.03
402 0.03
403 0.03
404 0.03
405 0.03
406 0.03
407 0.03
408 0.03
409 0.03
410 0.04
411 0.04
412 0.05
413 0.05
414 0.06
415 0.06
416 0.06
417 0.08
418 0.08
419 0.08
420 0.08
421 0.08
422 0.08
423 0.08
424 0.08
425 0.07
426 0.06
427 0.07
428 0.08
429 0.08
430 0.07
431 0.07
432 0.07
433 0.07
434 0.08
435 0.1
436 0.1
437 0.1
438 0.19
439 0.19
440 0.21
441 0.24
442 0.22
443 0.22
444 0.22
445 0.22
446 0.13
447 0.13
448 0.11
449 0.09
450 0.1
451 0.09
452 0.09
453 0.1
454 0.11
455 0.15
456 0.17
457 0.21
458 0.27
459 0.29
460 0.3
461 0.38
462 0.43
463 0.42
464 0.49
465 0.52
466 0.51
467 0.5
468 0.51
469 0.44
470 0.37
471 0.35
472 0.26
473 0.2
474 0.14
475 0.13
476 0.12
477 0.1
478 0.11
479 0.13
480 0.13
481 0.11
482 0.11
483 0.11
484 0.19
485 0.2
486 0.19
487 0.17
488 0.17
489 0.18
490 0.19
491 0.19
492 0.11
493 0.1
494 0.1
495 0.09
496 0.08
497 0.07
498 0.05
499 0.05
500 0.05
501 0.05
502 0.06
503 0.06
504 0.06
505 0.07
506 0.07
507 0.07
508 0.08
509 0.11
510 0.11
511 0.11
512 0.12
513 0.13
514 0.19
515 0.26
516 0.25
517 0.23
518 0.23
519 0.23
520 0.23
521 0.23
522 0.19
523 0.12
524 0.11
525 0.1
526 0.11
527 0.11
528 0.09
529 0.09
530 0.07
531 0.08
532 0.08
533 0.08
534 0.08
535 0.07
536 0.07
537 0.08
538 0.12
539 0.12
540 0.14
541 0.19
542 0.23
543 0.27
544 0.32
545 0.38
546 0.39
547 0.43
548 0.5
549 0.51
550 0.58
551 0.65
552 0.71
553 0.74
554 0.8
555 0.85
556 0.83
557 0.83
558 0.81
559 0.82
560 0.8
561 0.78
562 0.78
563 0.76
564 0.74
565 0.7
566 0.64
567 0.57
568 0.51
569 0.46
570 0.4
571 0.41
572 0.48
573 0.57
574 0.65
575 0.73
576 0.8