FuNGI

A0A0L0RYU5

Protein Details

Accession

A0A0L0RYU5

Localization Confidence

High

Confidence Score

16.7

NoLS Segment(s)

Position	Sequence	Protein Nature
554-596	LGTRAGRRRLRASPARRRGRTQLLQESPCEQAQRRRRPCKKFT	Hydrophilic

NLS Segment(s)

Position	Sequence
246-286	KRCKGGPGKKRKGISAEEKEARKQERVMRNRIAAQESRNKK
557-573	RAGRRRLRASPARRRGR

Subcellular Location(s)

nucl 18, cyto 5, mito 2, plas 2

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf IPR044280 Hac1/HY5
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006986 P:response to unfolded protein
Pfam	View protein in Pfam PF00170 bZIP_1
PROSITE	View protein in PROSITE PS50217 BZIP PS00036 BZIP_BASIC
CDD	cd14691 bZIP_XBP1

Amino Acid Sequences

MPDSPPLSPISPLLLDSIRSRPAANDAMAATASPDPQSAAAGSSRWPMNLAATPMPMLAGFPGIAPLPSVPPMGTAWPGIAAPAATMPFVPTTSAAPVAAGAVPGFTVYWVPSAAVPNLVYPTGDTATPLPDLTSSLGTVASASWGLAQSMSPQVDTAPSSPWIMLSPTASPVHAEPSQPPTEPRSTARSTSTPLTPITATPTSESGSQSPSPDPDATPAPESSASRPKRKPLNIVVPPVPPLMEKRCKGGPGKKRKGISAEEKEARKQERVMRNRIAAQESRNKKRAWVEALETTTAELQDENATLVETNERLHKRVKLLEDENKALNSRLDAIMAEISAMRSGESSMPVVSSSQSSPASMAATSSPTTLDWMSPPLTGAFGASSYQIDPALDLSPWLVPDAAFDAAPMAVDAPAAAAAAPTSSDLADPTLTSSTLVSVTLDELTRLLFHDRAPGPAVSEALAYANRSLQWKRSIWNVEPWVKASLVLETWMACVRTVHWAMVAWVAARAVAASSSLAMPSSRAEMSVLRARAAMACGATADGPFGCKLVLGLGTRAGRRRLRASPARRRGRTQLLQESPCEQAQRRRRPCKKFT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.19
2	0.2
3	0.22
4	0.26
5	0.25
6	0.25
7	0.26
8	0.24
9	0.29
10	0.31
11	0.29
12	0.27
13	0.23
14	0.24
15	0.23
16	0.21
17	0.17
18	0.14
19	0.14
20	0.11
21	0.11
22	0.1
23	0.11
24	0.12
25	0.1
26	0.11
27	0.11
28	0.12
29	0.13
30	0.18
31	0.18
32	0.17
33	0.18
34	0.17
35	0.2
36	0.23
37	0.26
38	0.22
39	0.22
40	0.22
41	0.21
42	0.2
43	0.16
44	0.12
45	0.08
46	0.07
47	0.06
48	0.06
49	0.07
50	0.07
51	0.07
52	0.08
53	0.08
54	0.09
55	0.11
56	0.12
57	0.1
58	0.12
59	0.13
60	0.15
61	0.15
62	0.13
63	0.12
64	0.12
65	0.12
66	0.1
67	0.1
68	0.07
69	0.06
70	0.07
71	0.08
72	0.07
73	0.07
74	0.08
75	0.08
76	0.09
77	0.09
78	0.09
79	0.1
80	0.12
81	0.13
82	0.12
83	0.11
84	0.11
85	0.11
86	0.1
87	0.08
88	0.06
89	0.05
90	0.05
91	0.05
92	0.05
93	0.04
94	0.05
95	0.05
96	0.06
97	0.07
98	0.07
99	0.09
100	0.12
101	0.12
102	0.14
103	0.13
104	0.13
105	0.15
106	0.14
107	0.12
108	0.1
109	0.13
110	0.11
111	0.11
112	0.11
113	0.1
114	0.12
115	0.13
116	0.13
117	0.1
118	0.09
119	0.11
120	0.11
121	0.11
122	0.09
123	0.09
124	0.09
125	0.08
126	0.08
127	0.07
128	0.06
129	0.05
130	0.05
131	0.05
132	0.06
133	0.06
134	0.06
135	0.06
136	0.07
137	0.12
138	0.12
139	0.11
140	0.11
141	0.11
142	0.13
143	0.14
144	0.13
145	0.11
146	0.12
147	0.13
148	0.13
149	0.13
150	0.12
151	0.12
152	0.12
153	0.11
154	0.11
155	0.13
156	0.14
157	0.14
158	0.14
159	0.13
160	0.17
161	0.17
162	0.17
163	0.16
164	0.22
165	0.24
166	0.24
167	0.25
168	0.26
169	0.28
170	0.29
171	0.3
172	0.3
173	0.31
174	0.33
175	0.36
176	0.33
177	0.33
178	0.33
179	0.32
180	0.27
181	0.24
182	0.24
183	0.2
184	0.18
185	0.2
186	0.19
187	0.17
188	0.16
189	0.17
190	0.16
191	0.18
192	0.19
193	0.14
194	0.16
195	0.17
196	0.18
197	0.17
198	0.18
199	0.19
200	0.18
201	0.18
202	0.16
203	0.18
204	0.17
205	0.18
206	0.17
207	0.16
208	0.17
209	0.17
210	0.19
211	0.26
212	0.3
213	0.36
214	0.39
215	0.45
216	0.53
217	0.56
218	0.6
219	0.59
220	0.65
221	0.62
222	0.65
223	0.6
224	0.52
225	0.49
226	0.41
227	0.32
228	0.22
229	0.19
230	0.22
231	0.26
232	0.26
233	0.28
234	0.3
235	0.34
236	0.4
237	0.45
238	0.48
239	0.52
240	0.61
241	0.63
242	0.62
243	0.61
244	0.6
245	0.58
246	0.58
247	0.54
248	0.53
249	0.52
250	0.52
251	0.51
252	0.51
253	0.47
254	0.38
255	0.35
256	0.36
257	0.4
258	0.46
259	0.5
260	0.5
261	0.5
262	0.52
263	0.5
264	0.45
265	0.37
266	0.34
267	0.36
268	0.4
269	0.44
270	0.46
271	0.43
272	0.43
273	0.46
274	0.47
275	0.43
276	0.38
277	0.35
278	0.34
279	0.35
280	0.32
281	0.26
282	0.21
283	0.16
284	0.13
285	0.1
286	0.05
287	0.05
288	0.05
289	0.05
290	0.05
291	0.05
292	0.05
293	0.05
294	0.05
295	0.05
296	0.05
297	0.05
298	0.12
299	0.13
300	0.14
301	0.17
302	0.2
303	0.23
304	0.28
305	0.3
306	0.3
307	0.35
308	0.41
309	0.42
310	0.41
311	0.39
312	0.35
313	0.32
314	0.26
315	0.2
316	0.13
317	0.11
318	0.09
319	0.09
320	0.08
321	0.08
322	0.08
323	0.07
324	0.07
325	0.05
326	0.05
327	0.05
328	0.05
329	0.04
330	0.04
331	0.05
332	0.06
333	0.06
334	0.07
335	0.07
336	0.07
337	0.07
338	0.07
339	0.07
340	0.08
341	0.07
342	0.1
343	0.1
344	0.1
345	0.1
346	0.11
347	0.11
348	0.09
349	0.09
350	0.07
351	0.08
352	0.08
353	0.08
354	0.08
355	0.07
356	0.09
357	0.09
358	0.09
359	0.08
360	0.1
361	0.11
362	0.1
363	0.11
364	0.09
365	0.09
366	0.09
367	0.08
368	0.06
369	0.05
370	0.06
371	0.06
372	0.06
373	0.06
374	0.07
375	0.07
376	0.06
377	0.06
378	0.07
379	0.07
380	0.07
381	0.06
382	0.06
383	0.07
384	0.07
385	0.07
386	0.06
387	0.05
388	0.06
389	0.08
390	0.08
391	0.07
392	0.07
393	0.07
394	0.07
395	0.07
396	0.06
397	0.04
398	0.04
399	0.04
400	0.04
401	0.03
402	0.03
403	0.03
404	0.03
405	0.03
406	0.03
407	0.03
408	0.03
409	0.03
410	0.04
411	0.04
412	0.05
413	0.05
414	0.06
415	0.06
416	0.06
417	0.08
418	0.08
419	0.08
420	0.08
421	0.08
422	0.08
423	0.08
424	0.08
425	0.07
426	0.06
427	0.07
428	0.08
429	0.08
430	0.07
431	0.07
432	0.07
433	0.07
434	0.08
435	0.1
436	0.1
437	0.1
438	0.19
439	0.19
440	0.21
441	0.24
442	0.22
443	0.22
444	0.22
445	0.22
446	0.13
447	0.13
448	0.11
449	0.09
450	0.1
451	0.09
452	0.09
453	0.1
454	0.11
455	0.15
456	0.17
457	0.21
458	0.27
459	0.29
460	0.3
461	0.38
462	0.43
463	0.42
464	0.49
465	0.52
466	0.51
467	0.5
468	0.51
469	0.44
470	0.37
471	0.35
472	0.26
473	0.2
474	0.14
475	0.13
476	0.12
477	0.1
478	0.11
479	0.13
480	0.13
481	0.11
482	0.11
483	0.11
484	0.19
485	0.2
486	0.19
487	0.17
488	0.17
489	0.18
490	0.19
491	0.19
492	0.11
493	0.1
494	0.1
495	0.09
496	0.08
497	0.07
498	0.05
499	0.05
500	0.05
501	0.05
502	0.06
503	0.06
504	0.06
505	0.07
506	0.07
507	0.07
508	0.08
509	0.11
510	0.11
511	0.11
512	0.12
513	0.13
514	0.19
515	0.26
516	0.25
517	0.23
518	0.23
519	0.23
520	0.23
521	0.23
522	0.19
523	0.12
524	0.11
525	0.1
526	0.11
527	0.11
528	0.09
529	0.09
530	0.07
531	0.08
532	0.08
533	0.08
534	0.08
535	0.07
536	0.07
537	0.08
538	0.12
539	0.12
540	0.14
541	0.19
542	0.23
543	0.27
544	0.32
545	0.38
546	0.39
547	0.43
548	0.5
549	0.51
550	0.58
551	0.65
552	0.71
553	0.74
554	0.8
555	0.85
556	0.83
557	0.83
558	0.81
559	0.82
560	0.8
561	0.78
562	0.78
563	0.76
564	0.74
565	0.7
566	0.64
567	0.57
568	0.51
569	0.46
570	0.4
571	0.41
572	0.48
573	0.57
574	0.65
575	0.73
576	0.8

A0A0L0RYU5

3D AlphaFold-predicted Structure Viewer