Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SE64

Protein Details
Accession A0A0L0SE64    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
432-469RAEPVRRRYRRICSTTRHAPRHPSRRPGPQQHHPWAWPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MPTAPGAMATASPAMTPPAPRPLAMPTSMSMVPTMHGMPATTFALSAAMYAAAPPTAMAAPIAGRLPVPVPMPVVYQHYPPYATVMHAATASARLPAPRGPAFPVDITSAMASSNFLSALDPVPVPAMPTPAGTNTTYAPRAPSLMAAVPSPVVVRRPPSAIPSPVVTASVPALPAPASTLSSPPPSAMASSPPVAPSPLVIRQESSTPSLTVPTEASGPLPVAASLLFTAQQQQAARAASASSPAPPSTPQPPSTPPSVSSSSSTPPSISSSTPPPPLPVTSTASPSTAVAAAAESEAPWPRMALSPALATSSACSPALPHDAHDTECSTPLGRGASSSSTAVALPVPANNYDDQGDDMDTAFAIPPEPPTAPVPLVDVAATGGHLGHAIGMGPTTPMTLTTTSGPPVSPGLAPQPSSLLFDPAELAPLARAEPVRRRYRRICSTTRHAPRHPSRRPGPQQHHPWAWPGPENAAGRDTGGVGAADRQGAAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.15
4 0.18
5 0.26
6 0.27
7 0.27
8 0.29
9 0.32
10 0.35
11 0.34
12 0.32
13 0.24
14 0.28
15 0.28
16 0.27
17 0.21
18 0.17
19 0.15
20 0.15
21 0.15
22 0.11
23 0.11
24 0.11
25 0.1
26 0.14
27 0.14
28 0.12
29 0.11
30 0.1
31 0.11
32 0.1
33 0.1
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.09
49 0.1
50 0.08
51 0.08
52 0.09
53 0.09
54 0.12
55 0.12
56 0.12
57 0.13
58 0.14
59 0.16
60 0.16
61 0.22
62 0.21
63 0.22
64 0.24
65 0.24
66 0.24
67 0.23
68 0.25
69 0.19
70 0.19
71 0.19
72 0.17
73 0.16
74 0.14
75 0.14
76 0.11
77 0.12
78 0.11
79 0.1
80 0.1
81 0.1
82 0.12
83 0.14
84 0.2
85 0.21
86 0.22
87 0.24
88 0.26
89 0.28
90 0.26
91 0.26
92 0.21
93 0.19
94 0.18
95 0.15
96 0.13
97 0.1
98 0.1
99 0.08
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.09
114 0.11
115 0.09
116 0.11
117 0.11
118 0.12
119 0.15
120 0.14
121 0.15
122 0.14
123 0.17
124 0.18
125 0.17
126 0.18
127 0.16
128 0.17
129 0.16
130 0.15
131 0.13
132 0.14
133 0.14
134 0.12
135 0.12
136 0.1
137 0.1
138 0.1
139 0.09
140 0.09
141 0.1
142 0.13
143 0.14
144 0.17
145 0.18
146 0.23
147 0.27
148 0.27
149 0.27
150 0.26
151 0.26
152 0.23
153 0.23
154 0.17
155 0.13
156 0.11
157 0.1
158 0.09
159 0.07
160 0.07
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.09
168 0.11
169 0.13
170 0.13
171 0.12
172 0.12
173 0.11
174 0.12
175 0.11
176 0.12
177 0.12
178 0.13
179 0.14
180 0.13
181 0.13
182 0.12
183 0.12
184 0.1
185 0.11
186 0.15
187 0.17
188 0.17
189 0.17
190 0.18
191 0.2
192 0.21
193 0.2
194 0.16
195 0.14
196 0.14
197 0.15
198 0.14
199 0.13
200 0.11
201 0.09
202 0.09
203 0.08
204 0.08
205 0.07
206 0.07
207 0.06
208 0.06
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.07
218 0.07
219 0.1
220 0.1
221 0.1
222 0.13
223 0.13
224 0.12
225 0.1
226 0.1
227 0.07
228 0.09
229 0.08
230 0.07
231 0.08
232 0.08
233 0.08
234 0.09
235 0.11
236 0.15
237 0.19
238 0.2
239 0.22
240 0.25
241 0.27
242 0.3
243 0.28
244 0.24
245 0.26
246 0.26
247 0.25
248 0.23
249 0.22
250 0.21
251 0.22
252 0.21
253 0.16
254 0.14
255 0.16
256 0.16
257 0.14
258 0.15
259 0.18
260 0.21
261 0.24
262 0.23
263 0.22
264 0.22
265 0.22
266 0.22
267 0.2
268 0.21
269 0.2
270 0.23
271 0.22
272 0.21
273 0.2
274 0.18
275 0.15
276 0.11
277 0.09
278 0.06
279 0.05
280 0.05
281 0.05
282 0.05
283 0.04
284 0.05
285 0.06
286 0.07
287 0.07
288 0.07
289 0.08
290 0.1
291 0.11
292 0.1
293 0.1
294 0.1
295 0.11
296 0.11
297 0.1
298 0.09
299 0.09
300 0.09
301 0.09
302 0.08
303 0.08
304 0.08
305 0.1
306 0.15
307 0.14
308 0.14
309 0.18
310 0.19
311 0.2
312 0.21
313 0.2
314 0.16
315 0.17
316 0.17
317 0.13
318 0.12
319 0.12
320 0.12
321 0.1
322 0.1
323 0.1
324 0.11
325 0.12
326 0.12
327 0.11
328 0.11
329 0.11
330 0.1
331 0.09
332 0.08
333 0.07
334 0.08
335 0.09
336 0.09
337 0.11
338 0.11
339 0.12
340 0.12
341 0.12
342 0.12
343 0.11
344 0.11
345 0.1
346 0.1
347 0.08
348 0.07
349 0.07
350 0.06
351 0.05
352 0.05
353 0.05
354 0.06
355 0.09
356 0.1
357 0.11
358 0.13
359 0.16
360 0.16
361 0.16
362 0.17
363 0.15
364 0.15
365 0.12
366 0.11
367 0.08
368 0.08
369 0.08
370 0.05
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.04
380 0.04
381 0.04
382 0.05
383 0.05
384 0.05
385 0.05
386 0.08
387 0.09
388 0.11
389 0.13
390 0.15
391 0.16
392 0.17
393 0.16
394 0.15
395 0.15
396 0.15
397 0.12
398 0.12
399 0.18
400 0.2
401 0.21
402 0.2
403 0.21
404 0.2
405 0.24
406 0.23
407 0.2
408 0.17
409 0.16
410 0.18
411 0.15
412 0.16
413 0.12
414 0.12
415 0.09
416 0.1
417 0.1
418 0.1
419 0.12
420 0.16
421 0.25
422 0.35
423 0.45
424 0.5
425 0.58
426 0.65
427 0.74
428 0.79
429 0.79
430 0.79
431 0.77
432 0.8
433 0.83
434 0.84
435 0.82
436 0.77
437 0.79
438 0.81
439 0.83
440 0.83
441 0.82
442 0.8
443 0.82
444 0.87
445 0.88
446 0.86
447 0.86
448 0.87
449 0.86
450 0.86
451 0.76
452 0.71
453 0.65
454 0.6
455 0.55
456 0.46
457 0.4
458 0.4
459 0.4
460 0.36
461 0.32
462 0.28
463 0.24
464 0.23
465 0.2
466 0.13
467 0.12
468 0.1
469 0.09
470 0.11
471 0.11
472 0.11
473 0.1