Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SWZ2

Protein Details
Accession A0A0L0SWZ2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33HDQARRPSRSAWSRPRRRRTEVPATTHydrophilic
NLS Segment(s)
PositionSequence
14-25PSRSAWSRPRRR
Subcellular Location(s) plas 11, mito 6, nucl 4, extr 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTVRMPAHDQARRPSRSAWSRPRRRRTEVPATTALLVAATVLAWLALLAPHAADAQQAADAVLVPATVSGLSPDDCFPIPASSKACPSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.58
4 0.63
5 0.65
6 0.67
7 0.75
8 0.83
9 0.89
10 0.87
11 0.86
12 0.86
13 0.84
14 0.84
15 0.78
16 0.73
17 0.66
18 0.59
19 0.51
20 0.42
21 0.32
22 0.2
23 0.14
24 0.08
25 0.05
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.06
58 0.07
59 0.08
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.17
66 0.18
67 0.22
68 0.25
69 0.25