Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SJM7

Protein Details
Accession A0A0L0SJM7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
181-201ASSPPRRPRRGGQHRRKLSWDBasic
NLS Segment(s)
PositionSequence
184-197PPRRPRRGGQHRRK
Subcellular Location(s) nucl 19, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MDGAPPPSFMAAAYPPPAASALTASLGGSNPGTILTQIPEDRALKLVPVPAPPPATTVVPPTPDTARLDTAPVAPIDAATMAEPTAAAPSQPLSPTRIRFRLQMAAGALTSPFTSSFSGSTSSAPASPSPPDLPPDAGTPTPLLSPDSPPGPIPTSPREPPSILRSAGGDSDPGAASSSPASSPPRRPRRGGQHRRKLSWDVPRAQTAAEPIGTSLSRDNTGSSSSRLIPRSQSSISPTSSNSGSWTRRATTSAVTARAQYQNGQYRHHRAATTASVPDIRTAASRPPPPQEASSGGGGET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.19
5 0.15
6 0.13
7 0.11
8 0.1
9 0.1
10 0.11
11 0.1
12 0.11
13 0.11
14 0.11
15 0.09
16 0.08
17 0.07
18 0.07
19 0.08
20 0.07
21 0.08
22 0.09
23 0.13
24 0.13
25 0.15
26 0.19
27 0.19
28 0.2
29 0.21
30 0.19
31 0.16
32 0.18
33 0.21
34 0.19
35 0.21
36 0.21
37 0.23
38 0.26
39 0.25
40 0.25
41 0.22
42 0.22
43 0.2
44 0.25
45 0.24
46 0.24
47 0.25
48 0.25
49 0.25
50 0.26
51 0.28
52 0.25
53 0.25
54 0.23
55 0.24
56 0.22
57 0.21
58 0.2
59 0.16
60 0.14
61 0.11
62 0.1
63 0.09
64 0.07
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.08
78 0.1
79 0.11
80 0.14
81 0.19
82 0.25
83 0.31
84 0.36
85 0.36
86 0.37
87 0.4
88 0.42
89 0.37
90 0.35
91 0.29
92 0.24
93 0.23
94 0.2
95 0.16
96 0.09
97 0.09
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.09
105 0.11
106 0.11
107 0.12
108 0.11
109 0.11
110 0.11
111 0.11
112 0.11
113 0.11
114 0.11
115 0.12
116 0.13
117 0.13
118 0.14
119 0.15
120 0.15
121 0.15
122 0.16
123 0.15
124 0.13
125 0.13
126 0.12
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.1
133 0.11
134 0.11
135 0.11
136 0.11
137 0.13
138 0.13
139 0.13
140 0.15
141 0.18
142 0.23
143 0.24
144 0.26
145 0.26
146 0.26
147 0.27
148 0.29
149 0.28
150 0.23
151 0.22
152 0.21
153 0.19
154 0.18
155 0.16
156 0.11
157 0.07
158 0.08
159 0.08
160 0.07
161 0.07
162 0.06
163 0.06
164 0.07
165 0.07
166 0.06
167 0.08
168 0.12
169 0.16
170 0.25
171 0.36
172 0.46
173 0.5
174 0.54
175 0.61
176 0.68
177 0.76
178 0.78
179 0.78
180 0.79
181 0.82
182 0.81
183 0.77
184 0.72
185 0.67
186 0.66
187 0.63
188 0.58
189 0.53
190 0.52
191 0.48
192 0.42
193 0.36
194 0.27
195 0.21
196 0.15
197 0.12
198 0.1
199 0.11
200 0.11
201 0.11
202 0.11
203 0.11
204 0.12
205 0.12
206 0.13
207 0.12
208 0.15
209 0.16
210 0.16
211 0.17
212 0.19
213 0.25
214 0.26
215 0.26
216 0.28
217 0.3
218 0.34
219 0.33
220 0.32
221 0.32
222 0.34
223 0.35
224 0.32
225 0.29
226 0.27
227 0.26
228 0.23
229 0.22
230 0.25
231 0.25
232 0.28
233 0.3
234 0.3
235 0.31
236 0.32
237 0.31
238 0.27
239 0.33
240 0.33
241 0.34
242 0.32
243 0.32
244 0.35
245 0.37
246 0.35
247 0.3
248 0.33
249 0.38
250 0.4
251 0.45
252 0.47
253 0.5
254 0.55
255 0.56
256 0.48
257 0.41
258 0.44
259 0.45
260 0.42
261 0.36
262 0.32
263 0.3
264 0.3
265 0.3
266 0.24
267 0.18
268 0.16
269 0.17
270 0.23
271 0.28
272 0.35
273 0.37
274 0.44
275 0.48
276 0.5
277 0.5
278 0.47
279 0.43
280 0.4
281 0.39