Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WPI9

Protein Details
Accession B2WPI9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-30SEWSERRLAKLRRRMNRSPTPLPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MASPKESEWSERRLAKLRRRMNRSPTPLPSPVLSRSPSPLALPPPLHTEQQAQSDGYPELLHPQPRLKYDPSKSPRFSDLCQQLPEPDKQAHRGFLESQLHDILAELDKTPSTTLSLRQQLKSQAHDILRLLNGLPPEPCTCPKHPDTAKDLGEARADNSKVMHLIPAKVPKAYLPAPNNQCRFNTLLRKASQLCQKAEAEVYMKIRIDGRFYVYNSVDPASRLAFEPSAHEKVINVAITSGEPAYNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.69
4 0.73
5 0.75
6 0.79
7 0.83
8 0.84
9 0.85
10 0.84
11 0.82
12 0.79
13 0.76
14 0.71
15 0.64
16 0.56
17 0.5
18 0.45
19 0.41
20 0.36
21 0.31
22 0.32
23 0.32
24 0.31
25 0.29
26 0.29
27 0.28
28 0.32
29 0.31
30 0.29
31 0.32
32 0.34
33 0.33
34 0.3
35 0.31
36 0.29
37 0.32
38 0.32
39 0.26
40 0.24
41 0.25
42 0.24
43 0.19
44 0.16
45 0.1
46 0.13
47 0.16
48 0.19
49 0.18
50 0.24
51 0.27
52 0.3
53 0.35
54 0.36
55 0.41
56 0.44
57 0.52
58 0.54
59 0.59
60 0.58
61 0.57
62 0.58
63 0.53
64 0.5
65 0.49
66 0.49
67 0.44
68 0.43
69 0.4
70 0.37
71 0.37
72 0.37
73 0.31
74 0.27
75 0.25
76 0.29
77 0.31
78 0.3
79 0.27
80 0.28
81 0.26
82 0.29
83 0.32
84 0.26
85 0.26
86 0.23
87 0.21
88 0.19
89 0.18
90 0.12
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.06
99 0.07
100 0.08
101 0.11
102 0.16
103 0.24
104 0.27
105 0.28
106 0.3
107 0.35
108 0.36
109 0.36
110 0.32
111 0.29
112 0.27
113 0.27
114 0.25
115 0.2
116 0.18
117 0.15
118 0.13
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.11
125 0.13
126 0.16
127 0.2
128 0.22
129 0.27
130 0.29
131 0.36
132 0.37
133 0.4
134 0.42
135 0.44
136 0.42
137 0.4
138 0.39
139 0.31
140 0.3
141 0.25
142 0.2
143 0.18
144 0.18
145 0.15
146 0.14
147 0.14
148 0.13
149 0.13
150 0.15
151 0.11
152 0.13
153 0.17
154 0.24
155 0.24
156 0.23
157 0.23
158 0.21
159 0.25
160 0.26
161 0.29
162 0.26
163 0.34
164 0.41
165 0.49
166 0.51
167 0.48
168 0.46
169 0.41
170 0.42
171 0.4
172 0.42
173 0.4
174 0.45
175 0.44
176 0.49
177 0.49
178 0.51
179 0.52
180 0.48
181 0.44
182 0.42
183 0.41
184 0.37
185 0.35
186 0.31
187 0.25
188 0.22
189 0.23
190 0.21
191 0.21
192 0.2
193 0.23
194 0.22
195 0.24
196 0.22
197 0.25
198 0.27
199 0.28
200 0.33
201 0.3
202 0.31
203 0.29
204 0.28
205 0.24
206 0.19
207 0.2
208 0.15
209 0.15
210 0.15
211 0.16
212 0.17
213 0.16
214 0.22
215 0.27
216 0.29
217 0.28
218 0.27
219 0.24
220 0.26
221 0.31
222 0.26
223 0.19
224 0.16
225 0.16
226 0.16
227 0.18
228 0.15