Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T852

Protein Details
Accession A0A0L0T852   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
228-282AAVVRRRTTKSRPRRMPPWPKRWPRCRERPRGPGARAKRRRRPLASPTAPRRKGSBasic
NLS Segment(s)
PositionSequence
219-289RPSRAPRNVAAVVRRRTTKSRPRRMPPWPKRWPRCRERPRGPGARAKRRRRPLASPTAPRRKGSLRARAPS
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000253  FHA_dom  
IPR045178  Fhl1/FHA1  
IPR008984  SMAD_FHA_dom_sf  
Gene Ontology GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00498  FHA  
PROSITE View protein in PROSITE  
PS50006  FHA_DOMAIN  
CDD cd22701  FHA_FKH1-like  
Amino Acid Sequences MDADDVAALSVPPADLLGAGSTDATHPPLRVAEQYPRGPDDEPQVSAYAKLAGHTWTYFITKTVITIGRASEVEEDPDVDLGPTKTVSRRHAVIQFNHASAGWEVAVTGRNGLKVNGNVFKPADPPVALRTATRFGSVARNSFSGSPPTRPTPPTTTRPSTRTTLPPRQLLPRRSPMTTSTATTITITTATATTTAPMTRVPCWSPLISSPPSSSSHPRPSRAPRNVAAVVRRRTTKSRPRRMPPWPKRWPRCRERPRGPGARAKRRRRPLASPTAPRRKGSLRARAPSARPNTTLSQPRSMSASCRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.08
10 0.09
11 0.11
12 0.12
13 0.12
14 0.14
15 0.16
16 0.18
17 0.21
18 0.25
19 0.3
20 0.36
21 0.41
22 0.43
23 0.43
24 0.42
25 0.39
26 0.37
27 0.36
28 0.32
29 0.29
30 0.27
31 0.27
32 0.25
33 0.24
34 0.22
35 0.18
36 0.14
37 0.13
38 0.13
39 0.13
40 0.14
41 0.14
42 0.15
43 0.13
44 0.15
45 0.15
46 0.15
47 0.15
48 0.13
49 0.13
50 0.17
51 0.18
52 0.17
53 0.18
54 0.18
55 0.18
56 0.18
57 0.19
58 0.17
59 0.15
60 0.15
61 0.14
62 0.14
63 0.12
64 0.12
65 0.11
66 0.08
67 0.09
68 0.08
69 0.08
70 0.08
71 0.1
72 0.14
73 0.19
74 0.23
75 0.26
76 0.27
77 0.32
78 0.39
79 0.43
80 0.42
81 0.44
82 0.43
83 0.39
84 0.37
85 0.32
86 0.26
87 0.2
88 0.18
89 0.1
90 0.07
91 0.06
92 0.07
93 0.08
94 0.07
95 0.08
96 0.08
97 0.1
98 0.1
99 0.11
100 0.13
101 0.14
102 0.18
103 0.21
104 0.2
105 0.21
106 0.21
107 0.21
108 0.19
109 0.2
110 0.18
111 0.14
112 0.14
113 0.14
114 0.17
115 0.16
116 0.15
117 0.15
118 0.17
119 0.16
120 0.16
121 0.14
122 0.12
123 0.2
124 0.21
125 0.2
126 0.19
127 0.19
128 0.19
129 0.2
130 0.2
131 0.19
132 0.19
133 0.2
134 0.21
135 0.24
136 0.26
137 0.26
138 0.29
139 0.31
140 0.35
141 0.38
142 0.42
143 0.44
144 0.45
145 0.46
146 0.46
147 0.41
148 0.39
149 0.42
150 0.43
151 0.47
152 0.48
153 0.49
154 0.47
155 0.54
156 0.58
157 0.54
158 0.52
159 0.52
160 0.5
161 0.47
162 0.47
163 0.4
164 0.38
165 0.35
166 0.3
167 0.23
168 0.2
169 0.2
170 0.18
171 0.16
172 0.11
173 0.09
174 0.08
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.07
183 0.07
184 0.09
185 0.1
186 0.11
187 0.14
188 0.15
189 0.17
190 0.2
191 0.19
192 0.19
193 0.2
194 0.24
195 0.23
196 0.23
197 0.22
198 0.22
199 0.24
200 0.26
201 0.3
202 0.32
203 0.41
204 0.44
205 0.46
206 0.52
207 0.59
208 0.66
209 0.68
210 0.67
211 0.59
212 0.61
213 0.62
214 0.58
215 0.55
216 0.53
217 0.5
218 0.48
219 0.49
220 0.46
221 0.49
222 0.55
223 0.59
224 0.61
225 0.67
226 0.73
227 0.78
228 0.83
229 0.88
230 0.89
231 0.89
232 0.89
233 0.89
234 0.9
235 0.92
236 0.93
237 0.92
238 0.91
239 0.91
240 0.91
241 0.92
242 0.91
243 0.9
244 0.9
245 0.9
246 0.85
247 0.84
248 0.83
249 0.83
250 0.84
251 0.84
252 0.85
253 0.85
254 0.9
255 0.87
256 0.86
257 0.85
258 0.86
259 0.85
260 0.86
261 0.86
262 0.87
263 0.83
264 0.75
265 0.71
266 0.66
267 0.66
268 0.65
269 0.65
270 0.64
271 0.66
272 0.73
273 0.74
274 0.73
275 0.72
276 0.71
277 0.65
278 0.58
279 0.56
280 0.53
281 0.54
282 0.59
283 0.54
284 0.55
285 0.5
286 0.49
287 0.49
288 0.45