Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SN88

Protein Details
Accession A0A0L0SN88    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
417-437VAMKREIGKAQKKAKKAKRRWBasic
NLS Segment(s)
PositionSequence
420-437KREIGKAQKKAKKAKRRW
Subcellular Location(s) mito 11, cyto 7, extr 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR030393  G_ENGB_dom  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS51706  G_ENGB  
Amino Acid Sequences MARSKALAAIARPVADALHAATAAAAAVPGATPTNPPSPPSVPSGVLELALSTPCQTTDPITIDHIPASRATPTTITIPTIDGDLPITDLHPLVSTPRRTYTPAQLQVASLFFGRPANLVRSVTSLDPPRAESDFPGATPAPAPAHDTVGPYLGGVPEVAFLGASNAGKSSLLRALMTKSSAKAAGLVGSQRAGATTSLNFYRVMHDPLLVVDMMGYGVGSRREWGKVIETYLAQRKELKRIYWLISAPSLLESRFALAEYDRAILDLVTSVRVPFTAVLTKIDVIPSTSAFLRCTDTLHRDLLDRAQGLGDTVLCTSAKSKITPAWDVRALGDPDLVRSVAPQLAGLKPPVLHSLGLVSATSDQARVEDGGVLLTRPGIAAVQAHILSATGQKMARWEGKVTKLATPKSPPVVDLVAMKREIGKAQKKAKKAKRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.16
4 0.1
5 0.1
6 0.09
7 0.09
8 0.08
9 0.08
10 0.07
11 0.06
12 0.05
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.06
19 0.08
20 0.12
21 0.19
22 0.2
23 0.22
24 0.27
25 0.29
26 0.31
27 0.35
28 0.35
29 0.3
30 0.3
31 0.32
32 0.26
33 0.23
34 0.21
35 0.16
36 0.13
37 0.11
38 0.11
39 0.08
40 0.08
41 0.09
42 0.1
43 0.1
44 0.12
45 0.17
46 0.19
47 0.2
48 0.24
49 0.25
50 0.25
51 0.26
52 0.24
53 0.19
54 0.18
55 0.18
56 0.17
57 0.16
58 0.16
59 0.15
60 0.16
61 0.19
62 0.2
63 0.19
64 0.17
65 0.17
66 0.16
67 0.16
68 0.15
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.11
81 0.18
82 0.22
83 0.24
84 0.28
85 0.3
86 0.35
87 0.39
88 0.44
89 0.47
90 0.5
91 0.5
92 0.47
93 0.45
94 0.42
95 0.38
96 0.28
97 0.18
98 0.11
99 0.09
100 0.09
101 0.09
102 0.09
103 0.11
104 0.13
105 0.16
106 0.17
107 0.17
108 0.18
109 0.2
110 0.2
111 0.22
112 0.22
113 0.21
114 0.21
115 0.22
116 0.23
117 0.22
118 0.22
119 0.18
120 0.2
121 0.18
122 0.17
123 0.19
124 0.16
125 0.15
126 0.14
127 0.15
128 0.11
129 0.11
130 0.14
131 0.11
132 0.14
133 0.15
134 0.16
135 0.15
136 0.15
137 0.14
138 0.11
139 0.11
140 0.08
141 0.07
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.03
149 0.04
150 0.06
151 0.06
152 0.05
153 0.06
154 0.06
155 0.06
156 0.07
157 0.08
158 0.09
159 0.09
160 0.1
161 0.1
162 0.13
163 0.14
164 0.16
165 0.15
166 0.13
167 0.14
168 0.14
169 0.13
170 0.12
171 0.11
172 0.1
173 0.1
174 0.1
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.08
185 0.09
186 0.1
187 0.1
188 0.1
189 0.12
190 0.13
191 0.15
192 0.14
193 0.14
194 0.13
195 0.12
196 0.13
197 0.1
198 0.07
199 0.05
200 0.04
201 0.04
202 0.03
203 0.03
204 0.02
205 0.03
206 0.04
207 0.04
208 0.05
209 0.06
210 0.07
211 0.08
212 0.09
213 0.12
214 0.12
215 0.14
216 0.14
217 0.14
218 0.16
219 0.22
220 0.22
221 0.19
222 0.24
223 0.24
224 0.31
225 0.34
226 0.32
227 0.3
228 0.34
229 0.37
230 0.35
231 0.34
232 0.27
233 0.24
234 0.23
235 0.19
236 0.16
237 0.13
238 0.09
239 0.09
240 0.07
241 0.08
242 0.08
243 0.08
244 0.07
245 0.06
246 0.07
247 0.08
248 0.09
249 0.07
250 0.08
251 0.07
252 0.07
253 0.06
254 0.07
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.07
262 0.06
263 0.07
264 0.1
265 0.11
266 0.12
267 0.13
268 0.14
269 0.14
270 0.14
271 0.12
272 0.09
273 0.1
274 0.09
275 0.09
276 0.1
277 0.11
278 0.11
279 0.12
280 0.14
281 0.14
282 0.16
283 0.19
284 0.22
285 0.24
286 0.25
287 0.24
288 0.23
289 0.24
290 0.24
291 0.23
292 0.19
293 0.17
294 0.15
295 0.14
296 0.13
297 0.13
298 0.1
299 0.06
300 0.06
301 0.07
302 0.07
303 0.07
304 0.08
305 0.13
306 0.15
307 0.15
308 0.17
309 0.2
310 0.25
311 0.31
312 0.33
313 0.33
314 0.34
315 0.33
316 0.32
317 0.35
318 0.31
319 0.25
320 0.25
321 0.19
322 0.18
323 0.19
324 0.17
325 0.11
326 0.1
327 0.12
328 0.11
329 0.11
330 0.11
331 0.12
332 0.14
333 0.16
334 0.17
335 0.16
336 0.15
337 0.17
338 0.19
339 0.18
340 0.15
341 0.14
342 0.15
343 0.14
344 0.14
345 0.12
346 0.1
347 0.09
348 0.1
349 0.1
350 0.09
351 0.08
352 0.08
353 0.1
354 0.1
355 0.09
356 0.09
357 0.09
358 0.1
359 0.1
360 0.1
361 0.08
362 0.08
363 0.07
364 0.06
365 0.06
366 0.05
367 0.05
368 0.06
369 0.08
370 0.11
371 0.11
372 0.11
373 0.11
374 0.11
375 0.11
376 0.13
377 0.12
378 0.12
379 0.12
380 0.13
381 0.17
382 0.23
383 0.28
384 0.28
385 0.32
386 0.36
387 0.42
388 0.48
389 0.47
390 0.48
391 0.5
392 0.52
393 0.53
394 0.53
395 0.53
396 0.55
397 0.53
398 0.47
399 0.43
400 0.41
401 0.36
402 0.36
403 0.34
404 0.31
405 0.3
406 0.3
407 0.28
408 0.28
409 0.32
410 0.35
411 0.4
412 0.45
413 0.55
414 0.62
415 0.69
416 0.78
417 0.83