Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T409

Protein Details
Accession A0A0L0T409    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-75AVPFHKHGNRDNKRKRKTFGGGPGAGNKKRRKDPLKGLKLBasic
NLS Segment(s)
PositionSequence
41-75KHGNRDNKRKRKTFGGGPGAGNKKRRKDPLKGLKL
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MLRHDKPIAPARVQPHLKNTPAYLLPSGVKEVKVSAVPFHKHGNRDNKRKRKTFGGGPGAGNKKRRKDPLKGLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.5
4 0.5
5 0.47
6 0.43
7 0.38
8 0.34
9 0.34
10 0.26
11 0.21
12 0.19
13 0.18
14 0.2
15 0.16
16 0.15
17 0.13
18 0.12
19 0.12
20 0.12
21 0.12
22 0.12
23 0.16
24 0.17
25 0.18
26 0.23
27 0.26
28 0.27
29 0.34
30 0.42
31 0.47
32 0.57
33 0.66
34 0.72
35 0.77
36 0.81
37 0.79
38 0.77
39 0.75
40 0.73
41 0.72
42 0.7
43 0.64
44 0.59
45 0.63
46 0.61
47 0.59
48 0.58
49 0.55
50 0.55
51 0.61
52 0.69
53 0.69
54 0.71
55 0.78