Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W2S1

Protein Details
Accession B2W2S1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPRKSSARKRKFQSARHEQPPQQRAHydrophilic
NLS Segment(s)
PositionSequence
9-11RKR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MAPRKSSARKRKFQSARHEQPPQQRATVKFRFADWSTLDRPTWEVKHEVPVEIVTAYPDDSSEYLGHIIRQYRPAVFAKAKPECIHCHRPFTTLHMSPASFLGHEDCFVYTMVHPMCEKTECHVAVDHVMETIKAEADLHIYGQMSARPEVKVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.84
5 0.85
6 0.8
7 0.81
8 0.79
9 0.72
10 0.66
11 0.62
12 0.58
13 0.59
14 0.59
15 0.54
16 0.47
17 0.45
18 0.46
19 0.42
20 0.41
21 0.35
22 0.34
23 0.32
24 0.33
25 0.32
26 0.26
27 0.27
28 0.27
29 0.25
30 0.22
31 0.23
32 0.21
33 0.29
34 0.29
35 0.27
36 0.23
37 0.21
38 0.19
39 0.16
40 0.15
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.08
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.1
55 0.12
56 0.12
57 0.15
58 0.16
59 0.15
60 0.18
61 0.19
62 0.21
63 0.21
64 0.23
65 0.27
66 0.28
67 0.3
68 0.28
69 0.29
70 0.3
71 0.35
72 0.43
73 0.38
74 0.42
75 0.41
76 0.42
77 0.4
78 0.4
79 0.41
80 0.32
81 0.32
82 0.27
83 0.26
84 0.25
85 0.25
86 0.2
87 0.12
88 0.11
89 0.11
90 0.09
91 0.09
92 0.09
93 0.08
94 0.09
95 0.09
96 0.1
97 0.07
98 0.13
99 0.13
100 0.14
101 0.14
102 0.14
103 0.16
104 0.17
105 0.18
106 0.16
107 0.24
108 0.23
109 0.24
110 0.24
111 0.23
112 0.24
113 0.24
114 0.2
115 0.13
116 0.13
117 0.11
118 0.11
119 0.11
120 0.08
121 0.07
122 0.07
123 0.07
124 0.09
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.12
131 0.14
132 0.14
133 0.17
134 0.18