FuNGI

A0A0L0SEP1

Protein Details

Accession

A0A0L0SEP1

Localization Confidence

Medium

Confidence Score

13.8

NoLS Segment(s)

Position	Sequence	Protein Nature
214-243	PPPPPPSAARRRQRSRSRSRSRDRARVRER	Basic
257-279	PQSRRGSRSGRERDRRRSSRSRS	Basic
296-317	LPPGGRRRSRSRTPPPPPGGRR	Basic

NLS Segment(s)

Position	Sequence
182-332	PPAPPSTRGRSRSPSRPRDAGPRVRRSNRMSPPPPPPPSAARRRQRSRSRSRSRDRARVRERDRDRYGNARRSLSPQSRRGSRSGRERDRRRSSRSRSPAGGAARRRSRSRSPPLPPGGRRRSRSRTPPPPPGGRRRSRSPLPHPRVRRAL

Subcellular Location(s)

cyto 7.5, mito 6, plas 6, cyto_nucl 5.5, extr 3, nucl 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036915 Cyclin-like_sf IPR043198 Cyclin/Ssn8
Gene Ontology	GO:0016538 F:cyclin-dependent protein serine/threonine kinase regulator activity GO:0006357 P:regulation of transcription by RNA polymerase II
CDD	cd20534 CYCLIN_CCNM_CCNQ_rpt1

Amino Acid Sequences

MFPPPGPGMPGAVAISSIPAGGGFGPAPRPGTGIIPADYIRVLAEWLRLPVTTTSSALVYFYRFDRYRKANSQSAHAHGLKTVDTLLFATACVYLATKTTDCNRKIRDVLNCAHSALRPDEPPMRIDTAHWKFRESLLAAELVLLRILKFELNVDLAYWPAIQYVRHLFRVHPAPPAPPVPPPAPPSTRGRSRSPSRPRDAGPRVRRSNRMSPPPPPPPSAARRRQRSRSRSRSRDRARVRERDRDRYGNARRSLSPQSRRGSRSGRERDRRRSSRSRSPAGGAARRRSRSRSPPLPPGGRRRSRSRTPPPPPGGRRRSRSPLPHPRVRRALSPPPPPLTWAPPPARFVVADMADQYQLPTIIDVPPAARFVLQTAWGFVADAYLRSSVLGWAAHDIALAAVAVALVLANAEQAPDVDQLCAAFRRPAGPVHEVVKWIVNTHELKPVRGSAGGSRRSASRRSLAAVVSANASGPSEEPVGMTSAPSS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.11
3	0.09
4	0.08
5	0.06
6	0.05
7	0.06
8	0.05
9	0.07
10	0.06
11	0.08
12	0.11
13	0.13
14	0.15
15	0.15
16	0.16
17	0.16
18	0.18
19	0.21
20	0.22
21	0.22
22	0.22
23	0.22
24	0.22
25	0.2
26	0.18
27	0.13
28	0.1
29	0.1
30	0.09
31	0.12
32	0.13
33	0.14
34	0.15
35	0.15
36	0.17
37	0.18
38	0.21
39	0.19
40	0.18
41	0.18
42	0.18
43	0.18
44	0.16
45	0.16
46	0.13
47	0.13
48	0.13
49	0.21
50	0.22
51	0.25
52	0.33
53	0.39
54	0.47
55	0.54
56	0.59
57	0.57
58	0.57
59	0.62
60	0.59
61	0.57
62	0.55
63	0.48
64	0.42
65	0.36
66	0.36
67	0.28
68	0.23
69	0.2
70	0.12
71	0.11
72	0.11
73	0.1
74	0.09
75	0.08
76	0.08
77	0.07
78	0.07
79	0.07
80	0.07
81	0.06
82	0.08
83	0.12
84	0.11
85	0.14
86	0.22
87	0.31
88	0.34
89	0.42
90	0.44
91	0.47
92	0.52
93	0.55
94	0.55
95	0.53
96	0.55
97	0.52
98	0.49
99	0.43
100	0.4
101	0.34
102	0.3
103	0.26
104	0.24
105	0.19
106	0.22
107	0.27
108	0.27
109	0.27
110	0.27
111	0.27
112	0.24
113	0.25
114	0.32
115	0.33
116	0.39
117	0.38
118	0.36
119	0.35
120	0.36
121	0.41
122	0.31
123	0.26
124	0.2
125	0.2
126	0.18
127	0.18
128	0.16
129	0.1
130	0.09
131	0.07
132	0.06
133	0.06
134	0.06
135	0.06
136	0.06
137	0.06
138	0.07
139	0.09
140	0.09
141	0.09
142	0.09
143	0.08
144	0.09
145	0.08
146	0.06
147	0.06
148	0.07
149	0.07
150	0.1
151	0.17
152	0.2
153	0.24
154	0.25
155	0.24
156	0.29
157	0.36
158	0.34
159	0.32
160	0.3
161	0.28
162	0.3
163	0.32
164	0.27
165	0.23
166	0.25
167	0.21
168	0.24
169	0.26
170	0.29
171	0.29
172	0.31
173	0.35
174	0.38
175	0.44
176	0.45
177	0.47
178	0.5
179	0.54
180	0.62
181	0.66
182	0.68
183	0.66
184	0.66
185	0.63
186	0.65
187	0.67
188	0.67
189	0.65
190	0.66
191	0.69
192	0.69
193	0.74
194	0.7
195	0.71
196	0.69
197	0.69
198	0.63
199	0.6
200	0.64
201	0.65
202	0.62
203	0.54
204	0.49
205	0.45
206	0.49
207	0.53
208	0.55
209	0.55
210	0.61
211	0.67
212	0.74
213	0.78
214	0.81
215	0.82
216	0.84
217	0.86
218	0.87
219	0.87
220	0.88
221	0.85
222	0.85
223	0.82
224	0.82
225	0.79
226	0.79
227	0.77
228	0.76
229	0.74
230	0.73
231	0.71
232	0.64
233	0.58
234	0.58
235	0.6
236	0.58
237	0.56
238	0.49
239	0.45
240	0.45
241	0.51
242	0.49
243	0.49
244	0.48
245	0.5
246	0.53
247	0.55
248	0.55
249	0.53
250	0.51
251	0.54
252	0.57
253	0.62
254	0.66
255	0.72
256	0.78
257	0.82
258	0.83
259	0.81
260	0.81
261	0.79
262	0.79
263	0.79
264	0.74
265	0.65
266	0.6
267	0.57
268	0.52
269	0.51
270	0.45
271	0.45
272	0.47
273	0.48
274	0.49
275	0.49
276	0.51
277	0.55
278	0.6
279	0.61
280	0.6
281	0.66
282	0.71
283	0.73
284	0.71
285	0.71
286	0.72
287	0.7
288	0.69
289	0.69
290	0.7
291	0.7
292	0.75
293	0.75
294	0.76
295	0.76
296	0.81
297	0.79
298	0.81
299	0.8
300	0.8
301	0.79
302	0.77
303	0.75
304	0.73
305	0.74
306	0.72
307	0.74
308	0.74
309	0.76
310	0.75
311	0.78
312	0.77
313	0.77
314	0.77
315	0.7
316	0.66
317	0.62
318	0.64
319	0.64
320	0.66
321	0.63
322	0.58
323	0.56
324	0.53
325	0.48
326	0.43
327	0.4
328	0.4
329	0.39
330	0.39
331	0.41
332	0.39
333	0.38
334	0.31
335	0.28
336	0.25
337	0.21
338	0.18
339	0.17
340	0.16
341	0.15
342	0.15
343	0.13
344	0.09
345	0.08
346	0.08
347	0.07
348	0.07
349	0.08
350	0.08
351	0.09
352	0.09
353	0.1
354	0.11
355	0.1
356	0.09
357	0.08
358	0.09
359	0.11
360	0.13
361	0.13
362	0.13
363	0.13
364	0.13
365	0.13
366	0.11
367	0.12
368	0.09
369	0.09
370	0.09
371	0.09
372	0.09
373	0.09
374	0.1
375	0.08
376	0.1
377	0.09
378	0.08
379	0.1
380	0.11
381	0.1
382	0.1
383	0.09
384	0.07
385	0.07
386	0.06
387	0.04
388	0.03
389	0.03
390	0.03
391	0.02
392	0.02
393	0.02
394	0.02
395	0.02
396	0.03
397	0.03
398	0.03
399	0.03
400	0.04
401	0.06
402	0.08
403	0.09
404	0.09
405	0.09
406	0.1
407	0.12
408	0.13
409	0.13
410	0.14
411	0.14
412	0.16
413	0.18
414	0.23
415	0.26
416	0.29
417	0.31
418	0.31
419	0.33
420	0.32
421	0.31
422	0.31
423	0.26
424	0.23
425	0.21
426	0.25
427	0.25
428	0.26
429	0.35
430	0.3
431	0.32
432	0.34
433	0.36
434	0.31
435	0.3
436	0.29
437	0.29
438	0.37
439	0.41
440	0.39
441	0.38
442	0.42
443	0.45
444	0.47
445	0.44
446	0.42
447	0.4
448	0.42
449	0.44
450	0.39
451	0.39
452	0.37
453	0.32
454	0.27
455	0.24
456	0.2
457	0.16
458	0.16
459	0.12
460	0.1
461	0.11
462	0.11
463	0.11
464	0.11
465	0.12
466	0.14
467	0.13

A0A0L0SEP1

3D AlphaFold-predicted Structure Viewer