Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0TF13

Protein Details
Accession A0A0L0TF13   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-128PMSSKRKKSSQHWDPMRNKNKPHKAGRVENNKRGKGRPQQRGKPIGGBasic
NLS Segment(s)
PositionSequence
78-125EVKLPMSSKRKKSSQHWDPMRNKNKPHKAGRVENNKRGKGRPQQRGKP
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MFLNHPKHLVRDTASYAPFHEALRTSNPALRNLARAFLGLTVQQGEHDSIEDARVAMLLYRLHRDDWEQFLRKLAKGEVKLPMSSKRKKSSQHWDPMRNKNKPHKAGRVENNKRGKGRPQQRGKPIGGDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.33
4 0.32
5 0.3
6 0.25
7 0.22
8 0.17
9 0.18
10 0.23
11 0.25
12 0.23
13 0.26
14 0.27
15 0.28
16 0.31
17 0.3
18 0.3
19 0.27
20 0.27
21 0.23
22 0.21
23 0.19
24 0.15
25 0.15
26 0.09
27 0.09
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.06
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.11
51 0.14
52 0.14
53 0.19
54 0.24
55 0.24
56 0.24
57 0.28
58 0.3
59 0.28
60 0.27
61 0.25
62 0.24
63 0.23
64 0.26
65 0.27
66 0.27
67 0.27
68 0.28
69 0.34
70 0.37
71 0.43
72 0.48
73 0.49
74 0.54
75 0.6
76 0.67
77 0.69
78 0.71
79 0.74
80 0.76
81 0.79
82 0.81
83 0.85
84 0.86
85 0.82
86 0.81
87 0.81
88 0.82
89 0.81
90 0.81
91 0.8
92 0.79
93 0.82
94 0.83
95 0.84
96 0.83
97 0.83
98 0.84
99 0.81
100 0.76
101 0.71
102 0.7
103 0.7
104 0.71
105 0.72
106 0.74
107 0.77
108 0.82
109 0.86
110 0.79
111 0.74